Clone RE49860 Report

Search the DGRC for RE49860

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:498
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG12338-RA
Protein status:RE49860.pep: gold
Preliminary Size:967
Sequenced Size:1124

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12338 2001-12-14 Blastp of sequenced clone
CG12338 2002-01-01 Sim4 clustering to Release 2
CG12338 2003-01-01 Sim4 clustering to Release 3
CG12338 2008-04-29 Release 5.5 accounting
CG12338 2008-08-15 Release 5.9 accounting
CG12338 2008-12-18 5.12 accounting

Clone Sequence Records

RE49860.complete Sequence

1124 bp (1124 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071416

> RE49860.complete
AGTACCAAATCGCCTTCCATTGGGATTGGGTATCAACTCAAAGCGGATCC
AGAATGCATTTCGGAGTCTTGGGAAGCGGTATCATTGGTCTTACGACCGC
CTTAGAACTCCAGAAGGAGTTTCCCACAGCAAGGGTTTCCGTGATTGCGG
ATCGGTTTAACGAGGACACCGTCAGCTATGTGGCGGCTGGAATTTTCCGA
CCTGGAACCAGCTTTATGGGCCCCACCCAGAAAATTACGCAACAATGGAT
GACCGATGCCTTCAACTACTGGGATGAGCTGCGTCGCTCCAAGGAGGCTC
CTCTGGCGGGCGTGTGCCAATTATCCGGCTATATTTACTCCCGCACCTCC
CCCTCCATCGTACGGAACCACTTTATTGAGAAACTATTGCCCGTCTACCG
AAGAGCCACCGAGGAGGAACTGAGGCTATGCAACGGCGGCTGGAAGTACG
GATCCTTCTTCACCACATGCCTAACGGAAAGCCGCCTCTTCTTGCCCTAT
GCCACTAAAAAATTCCTGGAGAACGGAGGAGAGGTTGTCCGTCAGCATGT
GAACAGCTTTTTCGAAGTGCCGCAGAACATTGACTTGCTCCTTAACTGCA
CCGGAATGGGAGCCAAGGAGTTGTGTGGGGACCAGCACTTGGTTCCCATT
CGGGGTCAAGTGCTCAAAGTGCGTGCTCCCTGGGTAAAGACGGCTTTCTA
CGGCGATTACGACACCTACGTTCTTCCCGGATTTGAGACTGTGACCCTGG
GAGGATGTCGCCAATTCGACAGCTACAACACCGAGTGGTGCAAATACGAT
AGCATGGCCATTCGAGAGCGTTGCTACGATTTGCTGCCCAGTCTCCGGAA
AGCGGAGATCGTGCGGGAATGTGTTGGTCTGCGGCCACACCGCTCCGTCG
TTCGGGTGGAGCCAGAACTGATCACGAATCCGGAAGGCAGGCGGCTGAAG
GTAGTCCACAACTACGGCCACGGCGGCTACGGTGTGACCACGGCTCCTGG
AACGGCTATGTACGCAGTTCGATTGGTACGCGATCTACTAGCGGGAAACA
GTAAACTGTAGGTGGTAAAATCGTTGTTAATTGTTGGTCATTAAACTCTT
TATACTCGAAAAAAAAAAAAAAAA

RE49860.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG12338-RA 1437 CG12338-RA 232..1338 1..1107 5535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6617158..6617753 1107..512 2980 100 Minus
chr2R 21145070 chr2R 6618239..6618479 241..1 1190 99.6 Minus
chr2R 21145070 chr2R 6617823..6617969 511..365 735 100 Minus
chr2R 21145070 chr2R 6618050..6618173 365..242 620 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10729593..10730188 1107..512 2980 100 Minus
2R 25286936 2R 10730674..10730914 241..1 1205 100 Minus
2R 25286936 2R 10730258..10730404 511..365 735 100 Minus
2R 25286936 2R 10730485..10730608 365..242 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10730792..10731387 1107..512 2980 100 Minus
2R 25260384 2R 10731873..10732113 241..1 1205 100 Minus
2R 25260384 2R 10731457..10731603 511..365 735 100 Minus
2R 25260384 2R 10731684..10731807 365..242 620 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:04:51 has no hits.

RE49860.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:05:45 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6617156..6617753 512..1108 99 <- Minus
chr2R 6617823..6617968 366..511 100 <- Minus
chr2R 6618050..6618173 242..365 100 <- Minus
chr2R 6618239..6618479 1..241 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:25 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1008 54..1061 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:09 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1008 54..1061 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:35 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1008 54..1061 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:48 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1008 54..1061 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:04 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1008 54..1061 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:31:33 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1107 1..1108 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:09 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1107 1..1108 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:35 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 5..1111 1..1108 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:50 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 1..1107 1..1108 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:04 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
CG12338-RA 5..1111 1..1108 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:45 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10729591..10730188 512..1108 99 <- Minus
2R 10730258..10730403 366..511 100 <- Minus
2R 10730485..10730608 242..365 100 <- Minus
2R 10730674..10730914 1..241 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:45 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10729591..10730188 512..1108 99 <- Minus
2R 10730258..10730403 366..511 100 <- Minus
2R 10730485..10730608 242..365 100 <- Minus
2R 10730674..10730914 1..241 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:45 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10729591..10730188 512..1108 99 <- Minus
2R 10730258..10730403 366..511 100 <- Minus
2R 10730485..10730608 242..365 100 <- Minus
2R 10730674..10730914 1..241 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:35 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6618179..6618419 1..241 100   Minus
arm_2R 6617096..6617693 512..1108 99 <- Minus
arm_2R 6617763..6617908 366..511 100 <- Minus
arm_2R 6617990..6618113 242..365 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:04:45 Download gff for RE49860.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10730790..10731387 512..1108 99 <- Minus
2R 10731457..10731602 366..511 100 <- Minus
2R 10731684..10731807 242..365 100 <- Minus
2R 10731873..10732113 1..241 100   Minus

RE49860.hyp Sequence

Translation from 2 to 1060

> RE49860.hyp
YQIAFHWDWVSTQSGSRMHFGVLGSGIIGLTTALELQKEFPTARVSVIAD
RFNEDTVSYVAAGIFRPGTSFMGPTQKITQQWMTDAFNYWDELRRSKEAP
LAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEELRLCNGGWKYG
SFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVPQNIDLLLNCT
GMGAKELCGDQHLVPIRGQVLKVRAPWVKTAFYGDYDTYVLPGFETVTLG
GCRQFDSYNTEWCKYDSMAIRERCYDLLPSLRKAEIVRECVGLRPHRSVV
RVEPELITNPEGRRLKVVHNYGHGGYGVTTAPGTAMYAVRLVRDLLAGNS
KL*

RE49860.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12338-PB 335 CG12338-PB 1..335 18..352 1786 100 Plus
CG12338-PA 335 CG12338-PA 1..335 18..352 1786 100 Plus
CG11236-PA 341 CG11236-PA 3..325 19..335 408 31.8 Plus
CG11236-PB 338 CG11236-PB 3..322 19..335 390 31.5 Plus

RE49860.pep Sequence

Translation from 53 to 1060

> RE49860.pep
MHFGVLGSGIIGLTTALELQKEFPTARVSVIADRFNEDTVSYVAAGIFRP
GTSFMGPTQKITQQWMTDAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSP
SIVRNHFIEKLLPVYRRATEEELRLCNGGWKYGSFFTTCLTESRLFLPYA
TKKFLENGGEVVRQHVNSFFEVPQNIDLLLNCTGMGAKELCGDQHLVPIR
GQVLKVRAPWVKTAFYGDYDTYVLPGFETVTLGGCRQFDSYNTEWCKYDS
MAIRERCYDLLPSLRKAEIVRECVGLRPHRSVVRVEPELITNPEGRRLKV
VHNYGHGGYGVTTAPGTAMYAVRLVRDLLAGNSKL*

RE49860.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11092-PA 335 GF11092-PA 1..335 1..335 1724 95.5 Plus
Dana\GF15429-PA 341 GF15429-PA 2..332 1..325 413 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22723-PA 335 GG22723-PA 1..335 1..335 1756 96.7 Plus
Dere\GG10434-PA 341 GG10434-PA 3..325 2..318 431 33 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24186-PA 335 GH24186-PA 1..335 1..335 1627 87.5 Plus
Dgri\GH20617-PA 335 GH20617-PA 1..335 1..335 1625 87.2 Plus
Dgri\GH13713-PA 341 GH13713-PA 2..332 1..325 414 31.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12338-PB 335 CG12338-PB 1..335 1..335 1786 100 Plus
CG12338-PA 335 CG12338-PA 1..335 1..335 1786 100 Plus
CG11236-PA 341 CG11236-PA 3..325 2..318 408 31.8 Plus
CG11236-PB 338 CG11236-PB 3..322 2..318 390 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20172-PA 335 GI20172-PA 1..335 1..335 1645 88.1 Plus
Dmoj\GI23973-PA 341 GI23973-PA 2..338 1..334 415 32.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17186-PA 335 GL17186-PA 1..335 1..335 1684 90.4 Plus
Dper\GL26186-PA 342 GL26186-PA 3..326 2..318 404 31.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11563-PA 335 GA11563-PA 1..335 1..335 1684 90.4 Plus
Dpse\GA10855-PA 342 GA10855-PA 3..326 2..318 404 31.3 Plus
Dpse\GA28065-PA 199 GA28065-PA 12..183 146..318 319 39.5 Plus
Dpse\GA24279-PA 327 GA24279-PA 3..286 2..285 285 27.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20499-PA 335 GM20499-PA 1..335 1..335 1756 97 Plus
Dsec\GM16217-PA 341 GM16217-PA 3..325 2..318 400 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25962-PA 335 GD25962-PA 1..335 1..335 1780 98.5 Plus
Dsim\GD23432-PA 341 GD23432-PA 3..325 2..318 403 31.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20129-PA 335 GJ20129-PA 1..335 1..335 1655 88.4 Plus
Dvir\GJ21247-PA 341 GJ21247-PA 2..341 1..335 423 33.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23907-PA 334 GK23907-PA 1..332 1..332 1597 84.9 Plus
Dwil\GK24241-PA 341 GK24241-PA 3..332 2..325 418 30.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13080-PA 335 GE13080-PA 1..335 1..335 1741 95.8 Plus
Dyak\GE14132-PA 341 GE14132-PA 3..325 2..318 408 31.2 Plus