Clone RE49877 Report

Search the DGRC for RE49877

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:498
Well:77
Vector:pFlc-1
Associated Gene/TranscriptArt8-RA
Protein status:RE49877.pep: gold
Preliminary Size:975
Sequenced Size:1225

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16840 2002-01-01 Sim4 clustering to Release 2
CG16840 2002-03-21 Blastp of sequenced clone
CG16840 2003-01-01 Sim4 clustering to Release 3
Art8 2008-04-29 Release 5.5 accounting
Art8 2008-08-15 Release 5.9 accounting
Art8 2008-12-18 5.12 accounting

Clone Sequence Records

RE49877.complete Sequence

1225 bp (1225 high quality bases) assembled on 2002-03-21

GenBank Submission: AY094881

> RE49877.complete
GTAGTTGATTAACACACCTCTATTTAGCACGTTGTTTTGAAAAATTCACT
TGATGCGTTAATGTTAATGTGTTGATAACTGCAACTTTAAATCATGGCGA
ACACTTATTTCGATGAGTATGAAAACTTGGAGATCCACGAGCTCATGCTG
AAGGATCGTCCTCGGCAAGAAGCCTACTACAATGCGATATTGGGGAATAA
GGATCTGTTCAAGGACAAGATCGTAATGGATGTTGGTGCCGGCACAGGGA
TTCTGTCCGCCTTTTGTGCGAAAGCAGGAGCCCGTTTGGTCTACGCCGTA
GAAGCATCCAATGTGGCCACCAAAGTTGCGCTGGATTTGATTGAGGATAA
CGGCCTGACGAACGTGGTGAAGGTGATCCAGTCGCGTGTTGAGGAATTCG
TACTGCCTGCCGAGGCGGAAAAGGTGGACATCATTGTGTCCGAGTGGATG
GGCTTCTACCTGCTGCACGAGGGCATGTTGGACTCGGTTCTCCTGGCCCG
GGACAAGTTCCTCAAGGAGGGTGGACTCCTGTTCCCCAGCGAGTGCACAA
TTTTCGTGGCACCCTGCTCGGTACCATCGCTCTTCGATGATTGGCACAAC
GTGGACGGCATCAAAATGGACACGTTTGCCAGAAAACTCAGAACCCAAAA
GTCATCCCGACCGGAGATTACACAGCTGAATCCGCAAGATCTTCTGCACG
AGGGCGTCGTCTTTCACTGGATGAATCTGCTGGATGTGGAAGCCAGCGAT
TTGGACAGCATTCAGTTCAAGGAGGTAATAACAGCCCAGAAGGCGGGCAA
TCACCAGGGCTTCTGCATTTGGTTCGATGTACAGTTTCCTGGCGAAGATT
TTGTTCTAAGCACATCGCCGCTATCCCCGCCAACGCATTGGAAGCAGTGT
GTAGTCGTCCTGCCCGAGGAATCCTGCGAAAATCTGGAGGAGAAGTCACC
CATTGCATTTCAAATCACAATGAAGCGCAGTGCTGCCGATATGCGTAAAT
ACAATCTGGAGGTGGATTTGCTAGACCCCAACACAGAGGAGCATCCAGTG
CCTTGCTCCTGTCACATGACGAAGTGCATTCTGACGGAAGCTCATCTAAA
AATGATGGACACCTCATGAGTTACATGCCATCTCGGAATCCGAACAACGA
TCTGTGGGGAAATCAATTTATTTAACATGTTTAATACAAATACAATATAT
ATCTCAGCCAAAAAAAAAAAAAAAA

RE49877.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Art8-RA 1325 Art8-RA 80..1291 1..1212 6045 99.9 Plus
Nup154.a 4766 Nup154.a 4445..4766 1151..830 1610 100 Minus
Nup154-RA 4577 Nup154-RA 4451..4577 1212..1086 620 99.2 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11008579..11009655 1207..131 5385 100 Minus
chr2L 23010047 chr2L 11009710..11009841 132..1 660 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11009818..11010899 1212..131 5395 99.9 Minus
2L 23513712 2L 11010954..11011085 132..1 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11009818..11010899 1212..131 5395 99.9 Minus
2L 23513712 2L 11010954..11011085 132..1 660 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:20:48 has no hits.

RE49877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:41 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11009710..11009841 1..132 100   Minus
chr2L 11008577..11009653 133..1209 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:27 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1026 94..1119 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:24:25 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1026 94..1119 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:11:40 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1026 94..1119 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:18 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1026 94..1119 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:24 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1026 94..1119 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:51:08 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1209 1..1209 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:24:25 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1209 1..1209 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:40 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 2..1210 1..1209 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:18 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 1..1209 1..1209 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:24 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
Art8-RA 2..1210 1..1209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:41 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11009821..11010897 133..1209 99 <- Minus
2L 11010954..11011085 1..132 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:41 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11009821..11010897 133..1209 99 <- Minus
2L 11010954..11011085 1..132 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:41 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11009821..11010897 133..1209 99 <- Minus
2L 11010954..11011085 1..132 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:40 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11009821..11010897 133..1209 99 <- Minus
arm_2L 11010954..11011085 1..132 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:19 Download gff for RE49877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11010954..11011085 1..132 100   Minus
2L 11009821..11010897 133..1209 99 <- Minus

RE49877.pep Sequence

Translation from 93 to 1118

> RE49877.pep
MANTYFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAG
TGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVE
EFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSE
CTIFVAPCSVPSLFDDWHNVDGIKMDTFARKLRTQKSSRPEITQLNPQDL
LHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQFPG
EDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADM
RKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAHLKMMDTS*

RE49877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14044-PA 343 GF14044-PA 3..343 2..341 1499 80.6 Plus
Dana\GF17088-PA 372 GF17088-PA 52..354 5..309 494 37.5 Plus
Dana\GF18899-PA 348 GF18899-PA 27..330 5..309 469 39.5 Plus
Dana\GF17144-PA 531 GF17144-PA 141..418 2..274 428 37.7 Plus
Dana\GF14882-PA 369 GF14882-PA 47..313 5..275 427 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10333-PA 341 GG10333-PA 1..341 1..341 1793 97.4 Plus
Dere\GG17013-PA 345 GG17013-PA 23..342 5..323 481 38.1 Plus
Dere\GG17264-PA 397 GG17264-PA 77..379 5..309 474 36.9 Plus
Dere\GG17314-PA 530 GG17314-PA 141..418 2..274 424 37.3 Plus
Dere\GG20792-PA 517 GG20792-PA 205..508 1..310 409 33.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13621-PA 342 GH13621-PA 2..342 3..341 1463 78.3 Plus
Dgri\GH19565-PA 382 GH19565-PA 62..364 5..309 485 37.2 Plus
Dgri\GH14177-PA 544 GH14177-PA 150..427 2..274 425 37.3 Plus
Dgri\GH18753-PA 507 GH18753-PA 200..498 5..310 411 31.9 Plus
Dgri\GH16647-PA 336 GH16647-PA 24..279 10..270 314 31.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Art8-PA 341 CG16840-PA 1..341 1..341 1792 100 Plus
Art1-PA 376 CG6554-PA 56..358 5..309 459 36.3 Plus
Art6-PA 341 CG9927-PA 19..322 5..309 448 38.1 Plus
Art4-PB 530 CG5358-PB 141..418 2..274 409 37.3 Plus
Art4-PA 530 CG5358-PA 141..418 2..274 409 37.3 Plus
Art3-PB 474 CG6563-PB 164..464 3..309 405 33.9 Plus
Art3-PA 516 CG6563-PA 206..506 3..309 405 33.9 Plus
Art2-PB 355 CG3675-PB 33..297 5..273 375 35 Plus
Art2-PA 355 CG3675-PA 33..297 5..273 375 35 Plus
CG32152-PC 357 CG32152-PC 9..276 7..275 250 28 Plus
CG32152-PB 357 CG32152-PB 9..276 7..275 250 28 Plus
Art9-PA 313 CG9929-PA 10..151 13..155 208 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20553-PA 341 GI20553-PA 2..341 3..341 1532 81.2 Plus
Dmoj\GI23860-PA 387 GI23860-PA 67..369 5..309 483 37.2 Plus
Dmoj\GI22087-PA 539 GI22087-PA 149..426 2..274 422 37 Plus
Dmoj\GI24669-PA 431 GI24669-PA 124..420 5..308 401 31.6 Plus
Dmoj\GI11605-PA 338 GI11605-PA 21..279 2..270 340 33.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20542-PA 260 GL20542-PA 1..260 83..341 1138 77.3 Plus
Dper\GL21930-PA 392 GL21930-PA 72..374 5..309 486 36.9 Plus
Dper\GL23322-PA 351 GL23322-PA 25..330 3..309 465 38 Plus
Dper\GL27288-PA 531 GL27288-PA 141..418 2..274 425 37.3 Plus
Dper\GL16439-PA 366 GL16439-PA 37..326 5..286 402 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19682-PA 392 GA19682-PA 72..374 5..309 486 36.9 Plus
Dpse\GA27221-PA 351 GA27221-PA 25..336 3..315 458 37.6 Plus
Dpse\GA18823-PA 531 GA18823-PA 141..418 2..274 425 37.3 Plus
Dpse\GA17605-PA 366 GA17605-PA 37..326 5..286 412 35.2 Plus
Dpse\GA19687-PB 481 GA19687-PB 173..472 5..310 395 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11203-PA 341 GM11203-PA 1..341 1..341 1813 98.8 Plus
Dsec\GM25897-PA 444 GM25897-PA 122..425 5..309 474 38.2 Plus
Dsec\GM26148-PA 397 GM26148-PA 77..379 5..309 466 36.2 Plus
Dsec\GM26200-PA 530 GM26200-PA 141..418 2..274 423 37.3 Plus
Dsec\GM25795-PA 516 GM25795-PA 204..507 1..310 418 33.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22203-PA 325 GD22203-PA 1..313 1..313 1615 96.8 Plus
Dsim\GD20467-PA 341 GD20467-PA 19..322 5..309 474 38.5 Plus
Dsim\GD20702-PA 397 GD20702-PA 77..379 5..309 471 36.5 Plus
Dsim\GD20747-PA 530 GD20747-PA 141..418 2..274 423 37.3 Plus
Dsim\GD20372-PA 477 GD20372-PA 165..468 1..310 418 33.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13894-PA 341 GJ13894-PA 2..341 3..341 1493 80.3 Plus
Dvir\GJ10573-PA 381 GJ10573-PA 61..363 5..309 482 37.2 Plus
Dvir\GJ24202-PA 538 GJ24202-PA 148..425 2..274 424 37.3 Plus
Dvir\GJ24043-PA 508 GJ24043-PA 201..497 5..308 417 31.4 Plus
Dvir\GJ11284-PA 311 GJ11284-PA 1..252 19..270 332 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14886-PA 340 GK14886-PA 1..340 1..340 1480 80.4 Plus
Dwil\GK13389-PA 382 GK13389-PA 62..364 5..309 494 37.5 Plus
Dwil\GK24448-PA 383 GK24448-PA 53..325 4..275 441 37.8 Plus
Dwil\GK22483-PA 344 GK22483-PA 17..287 5..273 436 38 Plus
Dwil\GK12781-PA 517 GK12781-PA 209..505 5..307 429 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13077-PA 341 GE13077-PA 1..341 1..341 1801 98.2 Plus
Dyak\GE24666-PA 378 GE24666-PA 58..360 5..309 481 37.2 Plus
Dyak\GE24405-PA 345 GE24405-PA 23..326 5..309 463 38.3 Plus
Dyak\GE24716-PA 530 GE24716-PA 141..418 2..274 426 37.3 Plus
Dyak\GE26400-PA 516 GE26400-PA 206..507 3..310 410 33.7 Plus

RE49877.hyp Sequence

Translation from 93 to 1118

> RE49877.hyp
MANTYFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAG
TGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVE
EFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSE
CTIFVAPCSVPSLFDDWHNVDGIKMDTFARKLRTQKSSRPEITQLNPQDL
LHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQFPG
EDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADM
RKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAHLKMMDTS*

RE49877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Art8-PA 341 CG16840-PA 1..341 1..341 1792 100 Plus
Art1-PA 376 CG6554-PA 56..358 5..309 459 36.3 Plus
Art6-PA 341 CG9927-PA 19..322 5..309 448 38.1 Plus
Art4-PB 530 CG5358-PB 141..418 2..274 409 37.3 Plus
Art4-PA 530 CG5358-PA 141..418 2..274 409 37.3 Plus