Clone RE49895 Report

Search the DGRC for RE49895

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:498
Well:95
Vector:pFlc-1
Associated Gene/TranscriptTwdlD-RA
Protein status:RE49895.pep: gold
Preliminary Size:762
Sequenced Size:980

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14243 2001-12-17 Blastp of sequenced clone
CG14243 2002-01-01 Sim4 clustering to Release 2
CG14243 2003-01-01 Sim4 clustering to Release 3
TwdlD 2008-04-29 Release 5.5 accounting
TwdlD 2008-08-15 Release 5.9 accounting
TwdlD 2008-12-18 5.12 accounting

Clone Sequence Records

RE49895.complete Sequence

980 bp (980 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071417

> RE49895.complete
GGCCTTAGTTCCTCCTGTCAGCTCCATTTGTACACAGCTTCCAGTCACCA
TGCGTGCTTTTATCGTCCTCTGTCTGTTGGCCGTGAGCTGCAGTGCCGAT
AAACTGGGCTACAACTACCAACCCGTGGCACATGCCGATGAGGGTCTGTC
CTTCCTGCCCGGAAGTGGTCAGGTGATTGGAGAACTTCCGTCGCAGGTGC
TGCCCGTGCAGAGTGGCGAAGCAGTCCTCTCCCAGCCCATTGAAGCACCT
GTTGCTCCCCAGATTGCACCTTTGGTAGAGGAGTTCCAGAAGGAGTTCTA
CAGCTACGCCGCCCCCGAGGAACAGTACGATGAGGGTGCCAGCAACCAGC
AGATCGCCAACTCCCTGAAAAAGAACCTCCGCGTCGTCTTCATTCGCACT
CCCGAAAATCAGGGCTTCGAGCGCGCTGCCCTCCAGTTGGCCAAGCAGTC
TGCTCAGCAGGAGACCGCCATCTATGTTCTCACCAAACAGTCCGATGTGT
CCAACCTGGCTAAGCAACTGAATGCCCTGAAGACGAGCTCCACCAACAAA
CCAGAGGTGCACTTCGTCAAGTACCGCACTCCAGAGGATGCGGCTAATGC
CCAACTGGCCATCCAGAACCAGTACAACCAATTGCCCGGCGTGTCTCGCA
TCTCCAACGAGGGTCGTGCTCCTGTCCTGAACTTTGCCTCGTCTCCAGCC
CAGGCTGCTGCCATCCCAGCCGTTGCTGCAGCTGCTCCCAGCTCGGAGTA
CCTGCCCGCCAATGTGGTGGCTGGCCAGGATTACCTGCCACCCAATCTGC
GTCGTTTCCGCGTCAAGTAAATGGTCTCAAGTGAAATTTCAACGGTAACG
CTTCCTATCCCAGAATATCGCATCGAAAAAAGAAAACACCTAGCTACTCC
CATCACGTGCAAGTTAACTAGCTTTTAAGTATCCATGTAGAGGAATAAAA
TTTGTTTTGCTGACAAAAAAAAAAAAAAAA

RE49895.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlD-RA 1055 TwdlD-RA 45..1007 5..967 4815 100 Plus
TwdlN-RA 1086 TwdlN-RA 745..841 538..634 275 85.5 Plus
TwdlL-RB 1073 TwdlL-RB 744..834 544..634 260 85.7 Plus
TwdlN-RA 1086 TwdlN-RA 647..703 440..496 180 87.7 Plus
TwdlL-RB 1073 TwdlL-RB 640..696 440..496 180 87.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22463276..22464175 65..964 4275 98.3 Plus
chr3R 27901430 chr3R 22455634..22455828 440..634 360 79 Plus
chr3R 27901430 chr3R 22447937..22448131 634..440 315 77.4 Minus
chr3R 27901430 chr3R 22442902..22443092 440..630 310 77.5 Plus
chr3R 27901430 chr3R 22445834..22446024 630..440 295 77 Minus
chr3R 27901430 chr3R 22463151..22463212 5..66 295 98.4 Plus
chr3R 27901430 chr3R 22480035..22480249 365..579 265 74.9 Plus
chr3R 27901430 chr3R 22451253..22451418 603..438 245 76.5 Minus
chr3R 27901430 chr3R 22453483..22453648 438..603 230 75.9 Plus
chr3R 27901430 chr3R 22449310..22449372 616..554 210 88.9 Minus
chr3R 27901430 chr3R 22443949..22444024 615..540 185 82.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26640155..26641057 65..967 4515 100 Plus
3R 32079331 3R 26632519..26632713 440..634 360 79 Plus
3R 32079331 3R 26624819..26625013 634..440 315 77.4 Minus
3R 32079331 3R 26640030..26640091 5..66 310 100 Plus
3R 32079331 3R 26619781..26619971 440..630 295 77 Plus
3R 32079331 3R 26622713..26622903 630..440 295 77 Minus
3R 32079331 3R 26656932..26657146 365..579 265 74.9 Plus
3R 32079331 3R 26628139..26628304 603..438 260 77.1 Minus
3R 32079331 3R 26630368..26630533 438..603 245 76.5 Plus
3R 32079331 3R 26626194..26626256 616..554 210 88.9 Minus
3R 32079331 3R 26620828..26620903 615..540 185 82.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26380986..26381888 65..967 4515 100 Plus
3R 31820162 3R 26380861..26380922 5..66 310 100 Plus
3R 31820162 3R 26373448..26373544 538..634 275 85.5 Plus
3R 31820162 3R 26365650..26365740 634..544 260 85.7 Minus
3R 31820162 3R 26363544..26363630 630..544 240 85 Minus
3R 31820162 3R 26360716..26360802 544..630 225 83.9 Plus
3R 31820162 3R 26368970..26369029 603..544 210 90 Minus
3R 31820162 3R 26367025..26367087 616..554 210 88.8 Minus
3R 31820162 3R 26371305..26371364 544..603 210 90 Plus
3R 31820162 3R 26397835..26397918 437..520 210 83.3 Plus
3R 31820162 3R 26361659..26361734 615..540 185 82.8 Minus
3R 31820162 3R 26373350..26373406 440..496 180 87.7 Plus
3R 31820162 3R 26360612..26360668 440..496 180 87.7 Plus
3R 31820162 3R 26365788..26365844 496..440 180 87.7 Minus
3R 31820162 3R 26371199..26371251 438..490 175 88.6 Plus
3R 31820162 3R 26369083..26369135 490..438 175 88.6 Minus
3R 31820162 3R 26363684..26363734 490..440 165 88.2 Minus
Blast to na_te.dros performed on 2019-03-16 08:08:18 has no hits.

RE49895.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:26 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22463147..22463210 1..64 95 -> Plus
chr3R 22463276..22464175 65..964 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:28 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 1..771 50..820 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:50 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 1..771 50..820 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:53:28 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 1..771 50..820 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:29 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 1..771 50..820 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:13 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 1..771 50..820 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:59 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 2..964 2..964 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:50 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 2..964 2..964 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:28 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 2..965 1..964 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:29 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 2..964 2..964 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:13 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlD-RA 2..965 1..964 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:26 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26640026..26640089 1..64 96 -> Plus
3R 26640155..26641054 65..964 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:26 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26640026..26640089 1..64 96 -> Plus
3R 26640155..26641054 65..964 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:26 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26640026..26640089 1..64 96 -> Plus
3R 26640155..26641054 65..964 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:28 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22465748..22465811 1..64 96 -> Plus
arm_3R 22465877..22466776 65..964 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:57 Download gff for RE49895.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26380986..26381885 65..964 100   Plus
3R 26380857..26380920 1..64 96 -> Plus

RE49895.hyp Sequence

Translation from 0 to 819

> RE49895.hyp
ALVPPVSSICTQLPVTMRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLS
FLPGSGQVIGELPSQVLPVQSGEAVLSQPIEAPVAPQIAPLVEEFQKEFY
SYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQGFERAALQLAKQS
AQQETAIYVLTKQSDVSNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANA
QLAIQNQYNQLPGVSRISNEGRAPVLNFASSPAQAAAIPAVAAAAPSSEY
LPANVVAGQDYLPPNLRRFRVK*

RE49895.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlD-PA 256 CG14243-PA 1..256 17..272 1282 100 Plus
TwdlK-PA 247 CG6460-PA 1..247 17..271 594 50 Plus
TwdlJ-PB 274 CG5471-PB 1..273 17..270 582 51.3 Plus
TwdlM-PA 288 CG5468-PA 1..284 17..255 569 45.2 Plus
TwdlL-PA 285 CG6447-PA 1..280 17..255 559 45.3 Plus

RE49895.pep Sequence

Translation from 49 to 819

> RE49895.pep
MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLPGSGQVIGELPSQV
LPVQSGEAVLSQPIEAPVAPQIAPLVEEFQKEFYSYAAPEEQYDEGASNQ
QIANSLKKNLRVVFIRTPENQGFERAALQLAKQSAQQETAIYVLTKQSDV
SNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQLPGVSR
ISNEGRAPVLNFASSPAQAAAIPAVAAAAPSSEYLPANVVAGQDYLPPNL
RRFRVK*

RE49895.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16449-PA 263 GF16449-PA 1..263 1..256 1098 84 Plus
Dana\GF16446-PA 245 GF16446-PA 1..241 1..240 496 47.6 Plus
Dana\GF18571-PA 234 GF18571-PA 1..228 1..237 493 45.4 Plus
Dana\GF18573-PA 246 GF18573-PA 1..216 1..212 487 54.3 Plus
Dana\GF16450-PA 256 GF16450-PA 1..210 1..225 465 48.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11494-PA 262 GG11494-PA 1..262 1..256 1148 90.5 Plus
Dere\GG12179-PA 239 GG12179-PA 1..233 1..239 583 52.5 Plus
Dere\GG11489-PA 274 GG11489-PA 1..273 1..254 556 51.1 Plus
Dere\GG12175-PA 244 GG12175-PA 1..238 1..237 489 46.6 Plus
Dere\GG12180-PA 229 GG12180-PA 1..229 1..256 435 42.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18732-PA 238 GH18732-PA 1..238 1..256 927 71.6 Plus
Dgri\GH18876-PA 232 GH18876-PA 1..232 1..255 616 52.5 Plus
Dgri\GH18726-PA 286 GH18726-PA 1..285 1..254 592 48.6 Plus
Dgri\GH19035-PA 207 GH19035-PA 1..204 1..238 510 49 Plus
Dgri\GH23186-PA 237 GH23186-PA 1..232 1..239 495 46.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlD-PA 256 CG14243-PA 1..256 1..256 1282 100 Plus
TwdlK-PA 247 CG6460-PA 1..247 1..255 594 50 Plus
TwdlJ-PB 274 CG5471-PB 1..273 1..254 582 51.3 Plus
TwdlM-PA 288 CG5468-PA 1..284 1..239 569 45.2 Plus
TwdlL-PA 285 CG6447-PA 1..280 1..239 559 45.3 Plus
TwdlB-PA 286 CG6478-PA 1..280 1..239 559 47 Plus
TwdlH-PA 241 CG31080-PA 1..237 1..240 536 51.4 Plus
TwdlL-PB 279 CG6447-PB 1..274 7..239 531 44.1 Plus
TwdlQ-PA 245 CG14250-PA 1..239 1..237 504 47.3 Plus
TwdlN-PA 309 CG5476-PA 104..302 38..240 483 51.7 Plus
TwdlP-PA 220 CG14240-PA 1..216 1..241 481 45.6 Plus
TwdlO-PA 229 CG6452-PA 1..229 1..256 458 43.1 Plus
Tb-PA 283 CG5480-PA 1..282 1..240 441 41.7 Plus
TwdlR-PA 325 CG31081-PA 11..225 1..247 306 38.7 Plus
TwdlV-PA 251 CG14640-PA 1..250 1..249 290 33.7 Plus
TwdlW-PA 308 CG4060-PA 73..264 33..215 262 36.4 Plus
TwdlF-PA 354 CG14639-PA 141..277 81..214 250 39.4 Plus
TwdlG-PC 278 CG14643-PC 1..278 1..241 236 28.6 Plus
TwdlG-PB 278 CG14643-PB 1..278 1..241 236 28.6 Plus
TwdlG-PA 278 CG14643-PA 1..278 1..241 236 28.6 Plus
TwdlS-PA 228 CG14242-PA 50..228 82..252 229 36.3 Plus
TwdlY-PA 247 CG32570-PA 7..243 5..237 228 30 Plus
TwdlX-PA 346 CG32571-PA 146..297 78..231 216 35.1 Plus
TwdlZ-PB 210 CG32569-PB 26..194 67..234 195 34.5 Plus
Twdlalpha-PA 388 CG32574-PA 175..300 81..208 181 36.1 Plus
TwdlN-PA 309 CG5476-PA 1..41 1..42 154 69 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22884-PA 255 GI22884-PA 1..255 1..256 924 71.6 Plus
Dmoj\GI22878-PA 277 GI22878-PA 5..277 3..255 533 50 Plus
Dmoj\GI24731-PA 233 GI24731-PA 1..232 1..237 518 48.9 Plus
Dmoj\GI22881-PA 240 GI22881-PA 1..236 1..240 505 47.2 Plus
Dmoj\GI10846-PA 240 GI10846-PA 25..235 6..236 482 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23105-PA 254 GL23105-PA 1..254 1..256 1098 83.6 Plus
Dper\GL23102-PA 264 GL23102-PA 1..260 1..240 547 48.5 Plus
Dper\GL23100-PA 293 GL23100-PA 1..292 1..254 530 49.2 Plus
Dper\GL24438-PA 285 GL24438-PA 1..280 1..240 525 47.7 Plus
Dper\GL24435-PA 251 GL24435-PA 1..245 1..237 494 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12855-PA 254 GA12855-PA 1..254 1..256 1105 84 Plus
Dpse\GA26613-PA 250 GA26613-PA 1..244 1..239 571 54.5 Plus
Dpse\GA27141-PA 264 GA27141-PA 1..260 1..240 547 48.1 Plus
Dpse\GA27140-PB 264 GA27140-PB 1..260 1..239 513 48.7 Plus
Dpse\GA18905-PB 309 GA18905-PB 1..309 1..255 504 46.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10337-PA 256 GM10337-PA 1..256 1..256 1284 97.7 Plus
Dsec\GM10175-PA 247 GM10175-PA 1..247 1..255 531 49.6 Plus
Dsec\GM10331-PA 274 GM10331-PA 1..274 1..255 507 50.2 Plus
Dsec\GM10172-PA 244 GM10172-PA 1..241 1..240 492 46 Plus
Dsec\GM10334-PA 241 GM10334-PA 1..237 1..240 464 47.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21297-PA 256 GD21297-PA 1..256 1..256 1285 97.3 Plus
Dsim\GD18127-PA 247 GD18127-PA 1..247 1..255 523 49 Plus
Dsim\GD21292-PA 274 GD21292-PA 1..273 1..254 505 50.4 Plus
Dsim\GD18124-PA 245 GD18124-PA 1..242 1..240 492 48 Plus
Dsim\GD21294-PA 241 GD21294-PA 1..237 1..240 469 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14179-PA 255 GJ14179-PA 1..255 1..256 944 73.5 Plus
Dvir\GJ14173-PA 284 GJ14173-PA 1..283 1..254 569 47.5 Plus
Dvir\GJ14453-PA 215 GJ14453-PA 1..215 1..253 515 48.4 Plus
Dvir\GJ14557-PA 226 GJ14557-PA 1..225 1..237 508 47.1 Plus
Dvir\GJ14564-PA 262 GJ14564-PA 1..262 1..255 502 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13324-PA 260 GK13324-PA 1..260 1..256 1027 79.1 Plus
Dwil\GK13323-PA 246 GK13323-PA 1..242 1..240 530 52.2 Plus
Dwil\GK13959-PA 262 GK13959-PA 1..261 1..254 522 49.6 Plus
Dwil\GK13956-PA 242 GK13956-PA 1..236 1..237 504 46.9 Plus
Dwil\GK13964-PA 225 GK13964-PA 1..218 1..240 477 45.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23685-PA 268 GE23685-PA 1..268 1..256 1171 90.3 Plus
Dyak\GE10623-PA 247 GE10623-PA 1..247 1..255 531 50.6 Plus
Dyak\GE23679-PA 274 GE23679-PA 7..273 6..254 505 51.1 Plus
Dyak\GE10619-PA 245 GE10619-PA 1..242 1..240 499 45.1 Plus
Dyak\GE23681-PA 234 GE23681-PA 1..230 1..240 487 50.8 Plus