Clone RE49934 Report

Search the DGRC for RE49934

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:499
Well:34
Vector:pFlc-1
Associated Gene/TranscriptCG11447-RA
Protein status:RE49934.pep: gold
Preliminary Size:753
Sequenced Size:1001

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11447 2001-12-17 Blastp of sequenced clone
CG11447 2002-01-01 Sim4 clustering to Release 2
CG11447 2003-01-01 Sim4 clustering to Release 3
CG11447 2008-04-29 Release 5.5 accounting
CG11447 2008-08-15 Release 5.9 accounting
CG11447 2008-12-18 5.12 accounting

Clone Sequence Records

RE49934.complete Sequence

1001 bp (1001 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071418

> RE49934.complete
AGGAGGCGATCTAATTTCGATATTACACAATGCGTCTTGTTTTTACGGGT
AATTGTGTTTTTAAACGCCTGCTGCACACGGAAATAGGCGGAAAGTATGC
CAAACAGCAGCCGCGGAACCTCAAAGGACGGAGCAAGAGCTCCCAGGAGT
GGCTTACGCGCCAACTGGCGGATCCGTACGTGGAGAAGGCCCGCATGATG
AACTATCGCTGCCGGAGTGCCTTCAAATTACTGGAGATCGACGACAAATA
CGGAATACTGCGGCCCGGAGACACAGTTTTGGAATGCGGAGCTGCTCCTG
GCAGCTGGACCCAGGTGGCCGTGGAGCGGACCAATGCCAACGGAAAGCAG
GAGCGGGCGCCACAGGGAGCCGTCTTTAGCATCGACCTGTTGCATTTCCA
TGCTGTGCCGGGTGCCACAATCTTTGGCGGCATGGATTTCACTTCTTCGC
TGGCACAAAAGCGGCTGAGGGAAGCGTTACAAGACAGAAAGGTCAACTGC
GTGCTGTCCGATATGGCACCCAATGCCACCGGAGTGAGGATGCTGGACCA
GGAGAGCATCACTAACCTCTGCTACGAGGTGCTGCGCTTTGCCCTGGCCA
TGTCTGCTCCGCAGGCCCATCTGGTGGTCAAGGTGTGGGATAATGGCGAC
GTGCCCAAGCTGGAGCGAGATATGCTTAGGTTTTATGAGAAAGTGAAGAG
AGTAAAACCGCGCGCTAGCCGCGGAGACTCCGCCGAGCACTTCCTGGTGG
CCAGGAACTTTAAAGGAGCAACGGATAGTTAATTATTAACTGCGTTTTTT
GGACTAGTTGAATTAAAAGCTTTGTTAATTGACTGTAGCTTATATTGGAT
AGAATAACTAAAGGGAAGTAACCTAGGATTAATTTCATCTCAACATTTTT
GTTGATTTTCTTTTTGATGTTTTAATCTTTGTTGTTATATACAGTTCTGT
AACAAATTATATGAATTTAGTTGAGTATTAACAACCCAAAAAAAAAAAAA
A

RE49934.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11447-RA 984 CG11447-RA 1..984 4..987 4920 100 Plus
CG4572.a 1523 CG4572.a 1429..1523 989..895 475 100 Minus
CG4572-RD 1796 CG4572-RD 1702..1796 989..895 475 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15685530..15686513 4..987 4905 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19861617..19862602 4..989 4930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19602448..19603433 4..989 4930 100 Plus
Blast to na_te.dros performed 2019-03-15 20:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
aurora-element 4263 aurora-element DMAURA 4263bp Derived from AB022762 (d1268008) (Rel. 59, Last updated, Version 1). 3666..3727 265..326 112 64.5 Plus

RE49934.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:42 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15685528..15686513 1..987 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:30 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 1..753 30..782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:04 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 1..753 30..782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:11:44 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 1..753 30..782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:48 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 1..753 30..782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:25 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 1..753 30..782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:28 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 3..986 4..987 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:03 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 1..984 4..987 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:44 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 6..991 1..987 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:48 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 3..986 4..987 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:25 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
CG11447-RA 6..991 1..987 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:42 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19861615..19862600 1..987 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:42 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19861615..19862600 1..987 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:42 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19861615..19862600 1..987 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:44 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15687337..15688322 1..987 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:55 Download gff for RE49934.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19602446..19603431 1..987 99   Plus

RE49934.pep Sequence

Translation from 29 to 781

> RE49934.pep
MRLVFTGNCVFKRLLHTEIGGKYAKQQPRNLKGRSKSSQEWLTRQLADPY
VEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVER
TNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREAL
QDRKVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVV
KVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEHFLVARNFKGATDS
*

RE49934.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17621-PA 254 GF17621-PA 1..250 1..250 1255 92 Plus
Dana\GF10393-PA 817 GF10393-PA 13..200 48..244 205 30.5 Plus
Dana\GF17080-PA 301 GF17080-PA 10..209 48..244 198 30.1 Plus
Dana\GF23069-PA 405 GF23069-PA 10..205 48..244 190 26.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23538-PA 250 GG23538-PA 1..250 1..250 1304 96 Plus
Dere\GG21940-PA 300 GG21940-PA 10..207 48..244 206 29.3 Plus
Dere\GG14838-PA 321 GG14838-PA 10..205 48..244 200 27.9 Plus
Dere\GG17939-PA 816 GG17939-PA 13..200 48..244 197 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16178-PA 249 GH16178-PA 10..249 8..247 1116 84.6 Plus
Dgri\GH17878-PA 836 GH17878-PA 13..200 48..244 223 32 Plus
Dgri\GH14141-PA 311 GH14141-PA 10..210 48..245 204 27.2 Plus
Dgri\GH18555-PA 356 GH18555-PA 10..205 48..244 203 28.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11447-PA 250 CG11447-PA 1..250 1..250 1300 100 Plus
CG7009-PA 320 CG7009-PA 10..205 48..244 201 28.4 Plus
CG5220-PA 302 CG5220-PA 10..207 48..244 200 28.8 Plus
CG8939-PA 817 CG8939-PA 13..200 48..244 200 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22429-PA 254 GI22429-PA 5..248 3..246 1105 82.8 Plus
Dmoj\GI10674-PA 305 GI10674-PA 10..210 48..245 206 28.2 Plus
Dmoj\GI16447-PA 826 GI16447-PA 13..200 48..244 197 29.4 Plus
Dmoj\GI24754-PA 382 GI24754-PA 10..205 48..244 195 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12202-PA 249 GL12202-PA 7..247 8..248 1150 88 Plus
Dper\GL12002-PA 316 GL12002-PA 10..205 48..244 205 28.4 Plus
Dper\GL24549-PA 304 GL24549-PA 10..209 48..244 184 31.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11008-PA 249 GA11008-PA 7..247 8..248 1144 87.6 Plus
Dpse\GA20027-PA 316 GA20027-PA 10..205 48..244 205 28.4 Plus
Dpse\GA18746-PA 304 GA18746-PA 10..209 48..244 184 31.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26867-PA 250 GM26867-PA 1..250 1..250 1318 97.2 Plus
Dsec\GM15097-PA 321 GM15097-PA 10..205 48..244 203 28.4 Plus
Dsec\GM15199-PA 302 GM15199-PA 10..207 48..244 197 29.1 Plus
Dsec\GM11680-PA 817 GM11680-PA 13..200 48..244 197 29.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19317-PA 250 GD19317-PA 1..250 1..250 1330 98.4 Plus
Dsim\GD19132-PA 302 GD19132-PA 10..207 48..244 199 29.6 Plus
Dsim\GD17262-PA 204 GD17262-PA 13..179 48..223 159 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10992-PA 254 GJ10992-PA 5..250 3..248 1097 81.7 Plus
Dvir\GJ23026-PA 313 GJ23026-PA 10..210 48..245 206 28.6 Plus
Dvir\GJ15847-PA 831 GJ15847-PA 13..200 48..244 202 29.9 Plus
Dvir\GJ22540-PA 316 GJ22540-PA 10..205 48..244 195 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22358-PA 249 GK22358-PA 9..248 8..246 1062 81.2 Plus
Dwil\GK16249-PA 306 GK16249-PA 10..209 48..244 227 30.3 Plus
Dwil\GK22383-PA 305 GK22383-PA 10..205 48..244 213 29.9 Plus
Dwil\GK19748-PA 824 GK19748-PA 13..200 48..244 201 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25629-PA 250 GE25629-PA 1..250 1..250 1293 95.6 Plus
Dyak\GE11211-PA 250 GE11211-PA 1..250 1..250 1283 95.2 Plus
Dyak\GE24604-PA 302 GE24604-PA 10..207 48..244 206 29.3 Plus
Dyak\GE25011-PA 318 GE25011-PA 10..205 48..244 202 27.9 Plus
Dyak\GE17245-PA 819 GE17245-PA 13..200 48..244 196 29.9 Plus

RE49934.hyp Sequence

Translation from 29 to 781

> RE49934.hyp
MRLVFTGNCVFKRLLHTEIGGKYAKQQPRNLKGRSKSSQEWLTRQLADPY
VEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVER
TNANGKQERAPQGAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREAL
QDRKVNCVLSDMAPNATGVRMLDQESITNLCYEVLRFALAMSAPQAHLVV
KVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEHFLVARNFKGATDS
*

RE49934.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11447-PA 250 CG11447-PA 1..250 1..250 1300 100 Plus
CG7009-PA 320 CG7009-PA 10..205 48..244 201 28.4 Plus
CG5220-PA 302 CG5220-PA 10..207 48..244 200 28.8 Plus
CG8939-PA 817 CG8939-PA 13..200 48..244 200 29.9 Plus