Clone RE49992 Report

Search the DGRC for RE49992

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:499
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG12540-RA
Protein status:RE49992.pep: gold
Preliminary Size:444
Sequenced Size:786

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12540 2002-01-01 Sim4 clustering to Release 2
CG12540 2003-01-01 Sim4 clustering to Release 3
CG12540 2008-04-29 Release 5.5 accounting
CG12540 2008-08-15 Release 5.9 accounting
CG12540 2008-12-18 5.12 accounting

Clone Sequence Records

RE49992.complete Sequence

786 bp (786 high quality bases) assembled on 2001-12-16

GenBank Submission: AY071419

> RE49992.complete
GCGGTCGACAAACGGCAGTTCCAGCATCAGCATCATAACTCGGCAACCCA
AGCTCGAGACTCGATACTCGACTTTTCTCCCAGAGGATCTCTTTCTACAG
GCAATTCCAAATGTTGCGCATACGCCGTGTGAGCCACGTGCAGCTGCTCG
TTCTAATGGCAATCGTTGTGGTGGTGACGGCAAAACAGGAAAGTTCAACG
CGTCAATTCGGCGGTGGCCAGAACTTCGGCAACGGCCTGGGCCCCTCCTT
TGGTGGCGTGGGCGCTGGTGGTCTAGGGCCTGGGGCCGGGTTTGGACCCG
GTTCCGCAGCCGGATATCCGGGACAAGGCGGCTACGGACCAGCGCAGCAG
CCGGGCTGCCCGCTGTGCGATTCGTCGGTTTACTCGTACTGCTCGCACAA
GATGGTACACGATGCCTGTTGCTGCGATTTTCCAGGCGGTGCCCCGCAGT
TGAGACCGCCCCAGTGTTTGTACTACGACTGCTCGCTGCTTTATGCCAAA
TCCTGTTACGAGCACGCCCTCATCAAGAACTGCTGCTGCAATAATCCCTA
CTGACGCGCCCATTTATCGGGAAAAATCGTGAGGTATCGGGAAATTGGAA
ATGGAAAATGGGAAATGTGAAATGCGGAGCGCCAAGTGATTTGTTTGCAC
TTCGGCTTCATTTATTTATTCAATACATTTAAAATGCATGTACAGCTATG
ATTTAAAATTAAGTTGCGTGCGATTGCTTGAAGCGCGCTAAATTAAATTA
AGTAATTTATTTGACAACCCAAAAAAAAAAAAAAAA

RE49992.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12540-RA 962 CG12540-RA 193..961 4..772 3845 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14387354..14387691 433..770 1660 99.4 Plus
chrX 22417052 chrX 14386990..14387232 194..436 1200 99.6 Plus
chrX 22417052 chrX 14386591..14386785 4..198 960 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14496903..14497242 433..772 1700 100 Plus
X 23542271 X 14496539..14496781 194..436 1200 99.6 Plus
X 23542271 X 14496140..14496334 4..198 975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14505001..14505340 433..772 1700 100 Plus
X 23527363 X 14504637..14504879 194..436 1200 99.5 Plus
X 23527363 X 14504238..14504432 4..198 975 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:55:10 has no hits.

RE49992.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:56:08 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14386588..14386785 1..198 98 -> Plus
chrX 14386995..14387231 199..435 100 -> Plus
chrX 14387357..14387691 436..770 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:31 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..444 111..554 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:35 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..444 111..554 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:00:21 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..444 111..554 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:09 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..444 111..554 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:12 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..444 111..554 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:00 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..770 1..770 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:35 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..770 1..770 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:00:21 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..770 1..770 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:09 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 1..770 1..770 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:12 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
CG12540-RA 3..772 1..770 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:08 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
X 14496137..14496334 1..198 99 -> Plus
X 14496544..14496780 199..435 100 -> Plus
X 14496906..14497240 436..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:08 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
X 14496137..14496334 1..198 99 -> Plus
X 14496544..14496780 199..435 100 -> Plus
X 14496906..14497240 436..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:08 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
X 14496137..14496334 1..198 99 -> Plus
X 14496544..14496780 199..435 100 -> Plus
X 14496906..14497240 436..770 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:00:21 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14390939..14391273 436..770 100   Plus
arm_X 14390170..14390367 1..198 99 -> Plus
arm_X 14390577..14390813 199..435 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:49 Download gff for RE49992.complete
Subject Subject Range Query Range Percent Splice Strand
X 14504642..14504878 199..435 100 -> Plus
X 14505004..14505338 436..770 100   Plus
X 14504235..14504432 1..198 99 -> Plus

RE49992.hyp Sequence

Translation from 0 to 543

> RE49992.hyp
QSTNGSSSISIITRQPKLETRYSTFLPEDLFLQAIPNVAHTPCEPRAAAR
SNGNRCGGDGKTGKFNASIRRWPELRQRPGPLLWWRGRWWSRAWGRVWTR
FRSRISGTRRLRTSAAAGLPAVRFVGLLVLLAQDGTRCLLLRFSRRCPAV
ETAPVFVLRLLAALCQILLRARPHQELLLQ*
Sequence RE49992.hyp has no blast hits.

RE49992.pep Sequence

Translation from 110 to 553

> RE49992.pep
MLRIRRVSHVQLLVLMAIVVVVTAKQESSTRQFGGGQNFGNGLGPSFGGV
GAGGLGPGAGFGPGSAAGYPGQGGYGPAQQPGCPLCDSSVYSYCSHKMVH
DACCCDFPGGAPQLRPPQCLYYDCSLLYAKSCYEHALIKNCCCNNPY*

RE49992.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22562-PA 138 GF22562-PA 1..138 1..147 409 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17845-PA 145 GG17845-PA 2..145 4..147 469 71.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11933-PA 131 GH11933-PA 8..131 3..147 347 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12540-PA 147 CG12540-PA 1..147 1..147 828 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16943-PA 69 GI16943-PA 35..69 113..147 154 80 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20142-PA 144 GL20142-PA 82..144 85..147 331 93.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11687-PA 148 GA11687-PA 1..148 1..147 342 64.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17678-PA 144 GM17678-PA 1..144 1..147 618 85 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17173-PA 145 GD17173-PA 1..145 1..147 696 95.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10320-PA 148 GK10320-PA 1..148 1..147 360 56.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17142-PA 150 GE17142-PA 1..150 1..147 474 82.9 Plus