Clone RE50009 Report

Search the DGRC for RE50009

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:500
Well:9
Vector:pFlc-1
Associated Gene/TranscriptCG2931-RA
Protein status:RE50009.pep: gold
Preliminary Size:957
Sequenced Size:1125

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2931 2001-12-14 Blastp of sequenced clone
CG2931 2002-01-01 Sim4 clustering to Release 2
CG2931 2003-01-01 Sim4 clustering to Release 3
CG2931 2008-04-29 Release 5.5 accounting
CG2931 2008-08-15 Release 5.9 accounting
CG2931 2008-12-18 5.12 accounting

Clone Sequence Records

RE50009.complete Sequence

1125 bp (1125 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071420

> RE50009.complete
GATATTTGTTTAGTACTCCGAGTTTTCTGCAGCACTTTCGTAAAAACTTG
CTTTGATTTGATTTTTTAAAAGAGAAAACCCCACTTCAAATGGGTACAAA
GCGTCGCAACATCGAGGATGAGCTCTCACGCTTCGAGGCGGAGATCTCGA
AGCCCCCCGCCCGCAATCTCTTCGTGCCCAACCAGGTGCGCCCGATCATA
GCCGCCAATACGTACCAAAACTCGCAGCACAAGCTGCAGCATCACCAGGG
CAATGGAGGATCGCGTCTGACCGTACCCCCGCCCCCGATGCCGCCTCCAC
CCACGTTTATGTCCACCTTCGTGCCTACGGGCAGTGGAGGTGGTTCTTCC
AAGGCTATGTCTGCCACTCCCGTAGTCCTGAGCAGCGCCCCCAAACTTTA
TCAGTGCCGGCAGTCTGTGCACGTGCCCACCGTGGCCGCCGCGCCCTCCA
TCGACATCAACGCCGTCTCTTTTGACGTAACGCAGAAGCTGAAGAAGCTC
AAGGCGGAAAAGTCTGGACCCAATCCCATTGCAGAGGAGGCCATTAAGGC
AGCGCGCGCATCATCGGCGCTGCAATCCTTCCAGACAACAGAGCGGAAAA
AGAAAGACCGCAAGACGGTGCGTATCGCTGGCGGCACCGTGTGGGAGGAT
ACTTCGCTGGCTGACTGGCCCGACGATGACTTCCGCATCTTTTGTGGTGA
CTTGGGAAACGACGTCAACGACGAGGTCCTGACCCGGACCTTCAACAAGT
TCCCCTCGTTTCAGCGGGCCCGTGTGGTGCGGGACAAGCGCACGGGCAAG
AGCAAGGGATTTGGCTTCGTGAGCTTCAGAGAACCGGCCGACTTTATACG
GGCCATGAAGGAGATGGACGGCCGCTATGTGGGCAGCCGGCCTATCAAAC
TGCGCAAGAGCACGTGGCGACAACGCAGTCTTGACGTAGTTAAGAAAAAG
GAGCGCGAAAAACAGGTGCTTCTGCAGGCCTTCAATTCCATGACTTGAAT
CTGAGTGTGCATATCGTGTCCTTTAGGCTAGTTTCGGTCACTTTGATGTA
GCAAATTAGATTTGGATGTTGCTGCTAAAGATGAGCAATAAATTTACGTT
TAGCAATCGAAAAAAAAAAAAAAAA

RE50009.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG2931-RA 1109 CG2931-RA 1..1107 1..1107 5535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1393163..1394269 1107..1 5535 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5567504..5568610 1107..1 5535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5308335..5309441 1107..1 5535 100 Minus
Blast to na_te.dros performed 2019-03-16 19:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 2003..2078 1089..1017 112 63.2 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 4200..4275 1089..1017 112 63.2 Minus
TART-C 11124 TART-C TARTC 11124bp 3455..3530 1089..1017 112 63.2 Minus

RE50009.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:18:34 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1393161..1394269 1..1109 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:32 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..909 90..998 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:50 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..909 90..998 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:28 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..909 90..998 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:01 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..909 90..998 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:31 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..909 90..998 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:51 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..1109 1..1109 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:50 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..1109 1..1109 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:28 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 6..1114 1..1109 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:02 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 1..1109 1..1109 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:31 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
CG2931-RA 6..1114 1..1109 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:18:34 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5567502..5568610 1..1109 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:18:34 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5567502..5568610 1..1109 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:18:34 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5567502..5568610 1..1109 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:28 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1393224..1394332 1..1109 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:17 Download gff for RE50009.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5308333..5309441 1..1109 99   Minus

RE50009.pep Sequence

Translation from 89 to 997

> RE50009.pep
MGTKRRNIEDELSRFEAEISKPPARNLFVPNQVRPIIAANTYQNSQHKLQ
HHQGNGGSRLTVPPPPMPPPPTFMSTFVPTGSGGGSSKAMSATPVVLSSA
PKLYQCRQSVHVPTVAAAPSIDINAVSFDVTQKLKKLKAEKSGPNPIAEE
AIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDFRI
FCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPA
DFIRAMKEMDGRYVGSRPIKLRKSTWRQRSLDVVKKKEREKQVLLQAFNS
MT*

RE50009.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11626-PA 310 GF11626-PA 1..309 1..301 1378 90.6 Plus
Dana\GF18875-PA 495 GF18875-PA 161..241 195..275 170 39.5 Plus
Dana\GF17967-PA 471 GF17967-PA 96..175 199..281 162 39.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10948-PA 305 GG10948-PA 1..305 1..302 1566 97.4 Plus
Dere\GG11588-PA 502 GG11588-PA 167..247 195..275 170 39.5 Plus
Dere\GG12380-PA 464 GG12380-PA 81..175 188..281 164 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22277-PA 300 GH22277-PA 1..300 1..302 1389 90.1 Plus
Dgri\GH17439-PA 520 GH17439-PA 175..255 195..275 170 39.5 Plus
Dgri\GH19101-PA 476 GH19101-PA 96..175 199..281 164 39.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2931-PA 302 CG2931-PA 1..302 1..302 1562 100 Plus
trv-PI 651 CG34362-PI 176..389 61..275 168 26.3 Plus
trv-PF 498 CG34362-PF 164..243 196..275 157 40 Plus
trv-PA 505 CG34362-PA 164..243 196..275 157 40 Plus
trv-PJ 508 CG34362-PJ 164..243 196..275 157 40 Plus
trv-PE 509 CG34362-PE 164..243 196..275 157 40 Plus
Rox8-PC 464 CG5422-PC 81..172 188..275 156 39.1 Plus
Rox8-PB 464 CG5422-PB 81..172 188..275 156 39.1 Plus
Rox8-PH 470 CG5422-PH 81..172 188..275 156 39.1 Plus
Rox8-PG 470 CG5422-PG 81..172 188..275 156 39.1 Plus
Rox8-PE 470 CG5422-PE 81..172 188..275 156 39.1 Plus
Rox8-PD 470 CG5422-PD 81..172 188..275 156 39.1 Plus
CG34354-PD 431 CG34354-PD 94..173 196..275 152 40 Plus
CG34354-PE 431 CG34354-PE 94..173 196..275 152 40 Plus
CG34354-PG 434 CG34354-PG 94..173 196..275 152 40 Plus
CG34354-PF 550 CG34354-PF 94..173 196..275 152 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23084-PA 302 GI23084-PA 1..302 1..302 1361 89.9 Plus
Dmoj\GI22766-PA 387 GI22766-PA 44..122 197..275 164 40.5 Plus
Dmoj\GI22960-PA 475 GI22960-PA 96..175 199..281 163 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22151-PA 303 GL22151-PA 1..302 1..301 1398 91.8 Plus
Dper\GL23648-PA 503 GL23648-PA 169..249 195..275 171 39.5 Plus
Dper\GL24152-PA 464 GL24152-PA 96..175 199..281 164 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15528-PA 303 GA15528-PA 1..302 1..301 1398 91.8 Plus
Dpse\GA26680-PA 503 GA26680-PA 169..249 195..275 171 39.5 Plus
Dpse\GA18869-PA 464 GA18869-PA 96..175 199..281 164 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10617-PA 147 GM10617-PA 4..147 162..302 732 96.5 Plus
Dsec\GM16370-PA 504 GM16370-PA 162..242 195..275 170 39.5 Plus
Dsec\GM23518-PA 464 GM23518-PA 81..175 188..281 165 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19605-PA 266 GD19605-PA 1..266 1..302 1365 87.4 Plus
Dsim\GD21364-PA 496 GD21364-PA 161..241 195..275 170 39.5 Plus
Dsim\GD21365-PA 363 GD21365-PA 95..174 196..275 160 40 Plus
Dsim\GD18328-PA 824 GD18328-PA 96..175 199..281 160 39.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22705-PA 302 GJ22705-PA 1..302 1..302 1348 90.8 Plus
Dvir\GJ22768-PA 504 GJ22768-PA 168..248 195..275 170 39.5 Plus
Dvir\GJ14540-PA 472 GJ14540-PA 96..175 199..281 164 39.8 Plus
Dvir\GJ22770-PA 401 GJ22770-PA 66..144 197..275 160 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12952-PA 302 GK12952-PA 1..301 1..301 1382 91.1 Plus
Dwil\GK22641-PA 521 GK22641-PA 178..258 195..275 170 39.5 Plus
Dwil\GK11939-PA 469 GK11939-PA 81..175 188..281 165 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24162-PA 305 GE24162-PA 1..305 1..302 1552 96.7 Plus
Dyak\GE23777-PA 543 GE23777-PA 165..288 156..275 173 33.8 Plus
Dyak\GE10834-PA 464 GE10834-PA 81..175 188..281 164 37.8 Plus

RE50009.hyp Sequence

Translation from 89 to 997

> RE50009.hyp
MGTKRRNIEDELSRFEAEISKPPARNLFVPNQVRPIIAANTYQNSQHKLQ
HHQGNGGSRLTVPPPPMPPPPTFMSTFVPTGSGGGSSKAMSATPVVLSSA
PKLYQCRQSVHVPTVAAAPSIDINAVSFDVTQKLKKLKAEKSGPNPIAEE
AIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDFRI
FCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPA
DFIRAMKEMDGRYVGSRPIKLRKSTWRQRSLDVVKKKEREKQVLLQAFNS
MT*

RE50009.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG2931-PA 302 CG2931-PA 1..302 1..302 1562 100 Plus
CG34362-PI 651 CG34362-PI 176..389 61..275 168 26.3 Plus
CG34362-PF 498 CG34362-PF 164..243 196..275 157 40 Plus
CG34362-PA 505 CG34362-PA 164..243 196..275 157 40 Plus
CG34362-PJ 508 CG34362-PJ 164..243 196..275 157 40 Plus