Clone RE50273 Report

Search the DGRC for RE50273

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:502
Well:73
Vector:pFlc-1
Associated Gene/Transcriptcib-RA
Protein status:RE50273.pep: gold
Preliminary Size:1273
Sequenced Size:909

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4944 2002-01-01 Sim4 clustering to Release 2
CG4944 2002-02-22 Blastp of sequenced clone
CG4944 2003-01-01 Sim4 clustering to Release 3
cib 2008-04-29 Release 5.5 accounting
cib 2008-08-15 Release 5.9 accounting
cib 2008-12-18 5.12 accounting

Clone Sequence Records

RE50273.complete Sequence

909 bp (909 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089633

> RE50273.complete
AGTGTTAAATTTGTGACGTCAAGAGCTCCGCTTCGCCACCATCGAAGGCC
CAGCTTCGCCAAGTGTACAGCTATACATAGAAACATATATCAGGCCGACC
CCGCCAGCATCCCAGCTTAGTAGTCCGCTTCGCCAATCCAAAAAAAAAAC
TAAATCAAGATGGCCGCCCCAGCACCAGCACTCAAGGATCTGCCCAAGGT
GGCCGAGAACCTGAAAAGCCAGTTGGAGGGATTCAACCAGGACAAACTGA
AGAACGCTAGCACCCAGGAGAAGATCATTCTTCCCACCGCCGAAGATGTG
GCTGCCGAGAAGACCCAACAGTCGATCTTCGAGGGCATCACCGCTTTCAA
TCAGAACAACTTGAAGCACACGGAGACCAACGAGAAGAACCCGTTGCCCG
ATAAGGAAGCCATCGAGCAGGAGAAGGAGAAGAATCAGTTCATCGCCGGC
ATCGAGAACTTTGATGCGAAAAAGTTGAAGCACACCGAGACCAATGAGAA
GAACGTGCTGCCCACCAAGGAGGTGATCGAGGCCGAGAAGCAGGCTTAAA
ATGGGGGCTCCAATGTGGTCCACTCCGATCCGAGATCCGAGATCTGAGAT
CCGATCCGATCCGATCCTCAGTCACCCCATCTCTCTTTTTCGACTCGCCG
CATCTCACTCTTTATACGTATAAAGCTATTCCCTCTCATTTTTCAACTGC
TACCAAGTTATTCGAACCGCTGCGCATGCGCGTGATAGCAAAAGTATTTT
ACTATTATCGTATTTCGGTTGTCCGTTTTTTTTTTTTTGCAATATTTTTA
CACATATATATATATATTTTTTGTATTAACAAGCAAGAGAGCCAGTCTCA
TTCCTACAGCGTAATTAACATAAAATAAACATTCGTCTATCCCAAAAAAA
AAAAAAAAA

RE50273.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RA 1007 cib-RA 109..1003 1..894 4420 99.7 Plus
cib.h 1394 cib.h 109..1003 1..894 4420 99.7 Plus
cib.e 1339 cib.e 549..1036 408..894 2400 99.7 Plus
cib.e 1339 cib.e 1..409 1..409 2030 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4003376..4003861 408..893 2430 100 Plus
chrX 22417052 chrX 3999341..3999499 1..159 765 98.7 Plus
chrX 22417052 chrX 4002913..4003050 158..295 690 100 Plus
chrX 22417052 chrX 4003121..4003236 294..409 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4110150..4110637 408..894 2390 99.8 Plus
X 23542271 X 4106115..4106273 1..159 780 99.4 Plus
X 23542271 X 4109687..4109824 158..295 690 100 Plus
X 23542271 X 4109895..4110010 294..409 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4118248..4118735 408..894 2400 99.7 Plus
X 23527363 X 4114213..4114371 1..159 780 99.3 Plus
X 23527363 X 4117785..4117922 158..295 690 100 Plus
X 23527363 X 4117993..4118108 294..409 580 100 Plus
Blast to na_te.dros performed 2019-03-16 03:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 216..344 623..747 112 59.5 Plus
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 1168..1296 747..623 112 59.5 Minus

RE50273.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:37:44 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3999341..3999499 1..159 98 -> Plus
chrX 4002915..4003050 160..295 100 -> Plus
chrX 4003123..4003236 296..409 100 -> Plus
chrX 4003378..4003861 410..893 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:44 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..549 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:37:50 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..549 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:47:13 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..549 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:32 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..549 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:09:50 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 160..549 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:03:01 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RA 1..894 1..893 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:37:50 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RA 1..894 1..893 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:47:13 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RA 3..896 1..893 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:32 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RA 1..894 1..893 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:09:50 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RA 3..896 1..893 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:44 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
X 4106115..4106273 1..159 99 -> Plus
X 4109689..4109824 160..295 100 -> Plus
X 4109897..4110010 296..409 100 -> Plus
X 4110152..4110636 410..893 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:44 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
X 4106115..4106273 1..159 99 -> Plus
X 4109689..4109824 160..295 100 -> Plus
X 4109897..4110010 296..409 100 -> Plus
X 4110152..4110636 410..893 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:44 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
X 4106115..4106273 1..159 99 -> Plus
X 4109689..4109824 160..295 100 -> Plus
X 4109897..4110010 296..409 100 -> Plus
X 4110152..4110636 410..893 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:47:13 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4003930..4004043 296..409 100 -> Plus
arm_X 4000148..4000306 1..159 99 -> Plus
arm_X 4003722..4003857 160..295 100 -> Plus
arm_X 4004185..4004669 410..893 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:36 Download gff for RE50273.complete
Subject Subject Range Query Range Percent Splice Strand
X 4118250..4118734 410..893 99   Plus
X 4114213..4114371 1..159 99 -> Plus
X 4117787..4117922 160..295 100 -> Plus
X 4117995..4118108 296..409 100 -> Plus

RE50273.pep Sequence

Translation from 159 to 548

> RE50273.pep
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIEN
FDAKKLKHTETNEKNVLPTKEVIEAEKQA*

RE50273.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20776-PA 130 GF20776-PA 1..130 1..129 601 94.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18692-PA 129 GG18692-PA 1..129 1..129 640 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24145-PA 129 GH24145-PA 1..129 1..129 605 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
cib-PE 129 CG4944-PE 1..129 1..129 650 100 Plus
cib-PD 129 CG4944-PD 1..129 1..129 650 100 Plus
cib-PB 129 CG4944-PB 1..129 1..129 650 100 Plus
cib-PA 129 CG4944-PA 1..129 1..129 650 100 Plus
cib-PC 97 CG4944-PC 1..88 1..88 422 95.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16398-PA 129 GI16398-PA 1..129 1..129 609 95.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21390-PA 129 GL21390-PA 1..129 1..129 611 95.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18544-PA 129 GA18544-PA 1..129 1..129 611 95.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12325-PA 129 GM12325-PA 1..129 1..129 640 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16670-PA 129 GD16670-PA 1..129 1..129 635 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17019-PA 129 GJ17019-PA 1..129 1..129 595 93 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15570-PA 143 GK15570-PA 15..143 1..129 613 95.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16331-PA 129 GE16331-PA 1..129 1..129 640 100 Plus

RE50273.hyp Sequence

Translation from 159 to 548

> RE50273.hyp
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIEN
FDAKKLKHTETNEKNVLPTKEVIEAEKQA*

RE50273.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
cib-PE 129 CG4944-PE 1..129 1..129 650 100 Plus
cib-PD 129 CG4944-PD 1..129 1..129 650 100 Plus
cib-PB 129 CG4944-PB 1..129 1..129 650 100 Plus
cib-PA 129 CG4944-PA 1..129 1..129 650 100 Plus
cib-PC 97 CG4944-PC 1..88 1..88 422 95.5 Plus