Clone RE50843 Report

Search the DGRC for RE50843

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:508
Well:43
Vector:pFlc-1
Associated Gene/TranscriptCG2852-RA
Protein status:RE50843.pep: gold
Preliminary Size:1344
Sequenced Size:898

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2852 2002-01-01 Sim4 clustering to Release 2
CG2852 2004-08-13 Blastp of sequenced clone
CG2852 2008-04-29 Release 5.5 accounting
CG2852 2008-08-15 Release 5.9 accounting
CG2852 2008-12-18 5.12 accounting

Clone Sequence Records

RE50843.complete Sequence

898 bp (898 high quality bases) assembled on 2006-06-05

GenBank Submission: BT021266

> RE50843.complete
GAAAATTCAGTCGTGAAATATCCATTGGCGACGTCGCTTGAGGAATAAAC
TGAAGCGCTGTGAATATTTAGAACGATGAAGCTGTTCTTATCCGTTTTCG
TGGTAGCCCTGGTGGCCGGCGTCGTTGTTGCCGACGATAGCAAGGGTCCC
AAAGTGACCGAGAAGGTTTTCTTTGACATCACCATTGGCGGCGAGCCCGC
TGGTCGCATCGAGATCGGTCTGTTCGGCAAGACGGTGCCCAAGACGGTGG
AGAACTTCAAGGAGCTGGCGCTGAAGCCGCAGGGCGAGGGCTACAAGGGC
AGCAAGTTCCACCGCATCATCAAGGACTTCATGATCCAGGGCGGTGACTT
CACCAAGGGCGACGGCACCGGCGGTCGCTCCATCTACGGCGAGCGCTTCG
AGGATGAGAACTTCAAGCTGAAGCACTATGGCGCCGGCTGGCTGAGCATG
GCCAACGCTGGCAAGGACACCAACGGATCGCAGTTCTTCATCACCACCAA
GCAGACCAGCTGGCTGGATGGACGCCACGTCGTCTTCGGCAAGATCCTGT
CGGGCATGAATGTGGTGCGCCAGATCGAGAACTCGGCCACTGATGCCCGC
GACCGTCCCGTCAAGGATGTGGTCATCGCCAACAGCGGCACCCTGCCCGT
TTCGGAGGCCTTCTCCGTGGCCAAGGCCGATGCCACCGACTAAAGTGTTT
GGGGAGCATGTCATCCATCAGCAACATAACCGATTTGAACTAAGCATAAA
CGCATAATCGATTTTTCCAGACATTTGCATTTACCATAGCTCGCCATGTT
TATTTACATTTCGTTCCGTAAGCAAGTAATTGTGCTCAACTAAAAACAGA
AATGGCATAAATAAAGAATGATTTTTTGTGTGAAAAAAAAAAAAAAAA

RE50843.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG2852-RA 1126 CG2852-RA 119..1005 1..887 4420 99.8 Plus
CG2852.a 941 CG2852.a 218..939 166..887 3595 99.8 Plus
nc_8670.a 622 nc_8670.a 140..622 290..772 2415 100 Plus
CG2852.a 941 CG2852.a 8..174 1..167 835 100 Plus
nc_8670.a 622 nc_8670.a 1..140 26..165 700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18531471..18532063 882..290 2950 99.8 Minus
chr2R 21145070 chr2R 18532725..18532891 167..1 820 99.4 Minus
chr2R 21145070 chr2R 18532462..18532588 290..164 620 99.2 Minus
chrX 22417052 chrX 16208057..16208253 488..292 280 76.1 Minus
chr2R 21145070 chr2R 2562423..2562629 495..289 225 73.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22644938..22645535 887..290 2975 99.8 Minus
2R 25286936 2R 22646180..22646346 167..1 835 100 Minus
2R 25286936 2R 22645921..22646047 290..164 635 100 Minus
X 23542271 X 16318339..16318535 488..292 280 76.1 Minus
2R 25286936 2R 6675226..6675432 495..289 225 73.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22646137..22646734 887..290 2975 99.8 Minus
2R 25260384 2R 22647379..22647545 167..1 835 100 Minus
2R 25260384 2R 22647120..22647246 290..164 635 100 Minus
2R 25260384 2R 6676547..6676631 373..289 200 82.3 Minus
X 23527363 X 16326535..16326633 390..292 180 78.7 Minus
3L 28103327 3L 542540..542578 344..306 165 94.8 Minus
X 23527363 X 16326437..16326522 488..403 160 79 Minus
3L 28103327 3L 542390..542436 494..448 145 87.2 Minus
Blast to na_te.dros performed on 2019-03-15 18:21:06 has no hits.

RE50843.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:22:08 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18531471..18532062 291..882 99 <- Minus
chr2R 18532462..18532586 166..290 99 <- Minus
chr2R 18532727..18532891 1..165 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:59 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..618 76..693 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:18 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..618 76..693 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:43 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..618 76..693 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:00 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..618 76..693 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:57 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..618 76..693 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:17 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:17 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:43 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..880 3..882 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:01 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:57 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
CG2852-RA 1..880 3..882 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:08 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22644943..22645534 291..882 100 <- Minus
2R 22645921..22646045 166..290 100 <- Minus
2R 22646182..22646346 1..165 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:08 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22644943..22645534 291..882 100 <- Minus
2R 22645921..22646045 166..290 100 <- Minus
2R 22646182..22646346 1..165 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:08 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22644943..22645534 291..882 100 <- Minus
2R 22645921..22646045 166..290 100 <- Minus
2R 22646182..22646346 1..165 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:43 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18532448..18533039 291..882 100 <- Minus
arm_2R 18533426..18533550 166..290 100 <- Minus
arm_2R 18533687..18533851 1..165 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:07 Download gff for RE50843.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22646142..22646733 291..882 100 <- Minus
2R 22647120..22647244 166..290 100 <- Minus
2R 22647381..22647545 1..165 100   Minus

RE50843.hyp Sequence

Translation from 75 to 692

> RE50843.hyp
MKLFLSVFVVALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLF
GKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGG
RSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGR
HVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAK
ADATD*

RE50843.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG2852-PD 205 CG2852-PD 1..205 1..205 1055 100 Plus
CG2852-PA 205 CG2852-PA 1..205 1..205 1055 100 Plus
Cyp1-PA 227 CG9916-PA 53..227 17..190 490 54 Plus
CG7768-PB 164 CG7768-PB 5..164 30..190 480 57.1 Plus
CG7768-PA 164 CG7768-PA 5..164 30..190 480 57.1 Plus

RE50843.pep Sequence

Translation from 75 to 692

> RE50843.pep
MKLFLSVFVVALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLF
GKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGG
RSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGR
HVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPVSEAFSVAK
ADATD*

RE50843.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13003-PA 205 GF13003-PA 1..205 1..205 982 91.7 Plus
Dana\GF11346-PA 394 GF11346-PA 219..393 22..190 494 55.1 Plus
Dana\GF19040-PA 155 GF19040-PA 1..155 35..190 468 56.4 Plus
Dana\GF13802-PA 183 GF13802-PA 19..183 31..190 468 53.9 Plus
Dana\GF15071-PA 235 GF15071-PA 4..200 1..202 445 43.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21776-PA 205 GG21776-PA 1..205 1..205 1035 96.1 Plus
Dere\GG19332-PA 227 GG19332-PA 53..227 17..190 502 54 Plus
Dere\GG21795-PA 300 GG21795-PA 121..299 18..190 488 53.9 Plus
Dere\GG10814-PA 183 GG10814-PA 19..183 31..190 462 53.9 Plus
Dere\GG24755-PA 236 GG24755-PA 24..194 27..194 450 48.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20332-PA 205 GH20332-PA 1..205 1..205 938 86.8 Plus
Dgri\GH14843-PA 164 GH14843-PA 5..164 30..190 493 56.5 Plus
Dgri\GH20760-PA 304 GH20760-PA 129..303 22..190 491 55.1 Plus
Dgri\GH10794-PA 165 GH10794-PA 6..165 30..190 487 57.1 Plus
Dgri\GH17842-PA 165 GH17842-PA 6..165 30..190 481 55.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG2852-PD 205 CG2852-PD 1..205 1..205 1055 100 Plus
CG2852-PA 205 CG2852-PA 1..205 1..205 1055 100 Plus
Cyp1-PA 227 CG9916-PA 53..227 17..190 490 54 Plus
cyp33-PA 300 CG4886-PA 121..299 18..190 481 54.4 Plus
CG7768-PB 164 CG7768-PB 5..164 30..190 480 57.1 Plus
CG7768-PA 164 CG7768-PA 5..164 30..190 480 57.1 Plus
CG17266-PB 183 CG17266-PB 19..183 31..190 454 53.9 Plus
CG17266-PA 183 CG17266-PA 19..183 31..190 454 53.9 Plus
ninaA-PA 237 CG3966-PA 25..195 27..194 446 49.1 Plus
Moca-cyp-PA 970 CG1866-PA 14..182 30..190 442 52.7 Plus
Cypl-PA 176 CG13892-PA 30..163 43..179 358 55.1 Plus
CG8336-PD 383 CG8336-PD 17..197 31..204 349 43.4 Plus
CG8336-PC 383 CG8336-PC 17..197 31..204 349 43.4 Plus
CG8336-PA 383 CG8336-PA 17..197 31..204 349 43.4 Plus
CG8336-PB 383 CG8336-PB 17..197 31..204 349 43.4 Plus
CG7747-PA 517 CG7747-PA 258..440 10..195 329 40.1 Plus
CG3511-PB 637 CG3511-PB 469..630 16..184 319 46.8 Plus
CG3511-PA 637 CG3511-PA 469..630 16..184 319 46.8 Plus
CG10907-PA 502 CG10907-PA 9..156 25..179 275 40.1 Plus
CG11777-PA 161 CG11777-PA 10..146 43..181 212 38.7 Plus
CG5808-PA 653 CG5808-PA 10..162 43..190 196 34.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\moj29-PA 205 GI20003-PA 1..205 1..205 944 86.8 Plus
Dmoj\GI13698-PA 165 GI13698-PA 6..165 30..190 495 57.8 Plus
Dmoj\GI21755-PA 165 GI21755-PA 6..165 30..190 484 55.9 Plus
Dmoj\GI13696-PA 166 GI13696-PA 6..164 31..190 484 57.5 Plus
Dmoj\GI13614-PA 164 GI13614-PA 5..164 30..190 478 55.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17482-PA 205 GL17482-PA 1..205 1..205 1004 93.7 Plus
Dper\GL11464-PA 302 GL11464-PA 127..301 22..190 489 54.5 Plus
Dper\GL23654-PA 939 GL23654-PA 14..182 30..190 469 54.4 Plus
Dper\GL10991-PA 183 GL10991-PA 19..183 31..190 462 53.3 Plus
Dper\GL16395-PA 236 GL16395-PA 1..194 1..194 457 45.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15486-PA 205 GA15486-PA 1..205 1..205 1004 93.7 Plus
Dpse\Cyp1-PA 226 GA22120-PA 53..226 18..190 491 53.7 Plus
Dpse\GA18502-PA 302 GA18502-PA 127..301 22..190 490 54.5 Plus
Dpse\GA14426-PA 183 GA14426-PA 19..183 31..190 462 53.3 Plus
Dpse\GA17809-PA 236 GA17809-PA 24..194 27..194 457 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15627-PA 205 GM15627-PA 1..205 1..205 1060 99.5 Plus
Dsec\GM13410-PA 227 GM13410-PA 53..227 17..190 503 54 Plus
Dsec\GM21798-PA 301 GM21798-PA 122..300 18..190 490 53.9 Plus
Dsec\GM25460-PA 164 GM25460-PA 5..164 30..190 484 57.8 Plus
Dsec\GM20863-PA 183 GM20863-PA 19..183 31..190 463 53.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25116-PA 203 GD25116-PA 1..203 1..205 1038 98.5 Plus
Dsim\GD11288-PA 301 GD11288-PA 122..300 18..190 490 53.9 Plus
Dsim\GD10314-PA 183 GD10314-PA 19..183 31..190 463 53.9 Plus
Dsim\GD20227-PA 155 GD20227-PA 1..155 35..190 438 53.2 Plus
Dsim\GD21371-PA 1003 GD21371-PA 14..182 30..190 435 52.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21252-PA 206 GJ21252-PA 1..206 1..205 932 86.9 Plus
Dvir\GJ19133-PA 223 GJ19133-PA 50..223 18..190 503 54.9 Plus
Dvir\GJ14038-PA 164 GJ14038-PA 5..164 30..190 491 55.9 Plus
Dvir\GJ13951-PA 164 GJ13951-PA 5..164 30..190 479 55.3 Plus
Dvir\GJ14037-PA 164 GJ14037-PA 5..162 30..188 475 56.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21428-PA 204 GK21428-PA 1..204 1..205 933 87.3 Plus
Dwil\GK14585-PA 165 GK14585-PA 3..165 27..190 505 57.9 Plus
Dwil\GK16511-PA 165 GK16511-PA 6..165 30..190 495 57.1 Plus
Dwil\GK23148-PA 183 GK23148-PA 15..183 27..190 465 52.7 Plus
Dwil\GK24444-PA 238 GK24444-PA 26..203 27..202 448 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11851-PA 205 GE11851-PA 1..205 1..205 1055 98.5 Plus
Dyak\Cyp1-PA 227 GE15979-PA 53..227 17..190 500 54 Plus
Dyak\GE11871-PA 300 GE11871-PA 121..299 18..190 488 53.9 Plus
Dyak\GE22008-PA 180 GE22008-PA 21..180 30..190 484 57.8 Plus
Dyak\GE24621-PA 183 GE24621-PA 19..183 31..190 463 53.9 Plus