Clone RE51580 Report

Search the DGRC for RE51580

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:515
Well:80
Vector:pFlc-1
Associated Gene/TranscriptAstA-R2-RA
Protein status:RE51580.pep: gold
Sequenced Size:2011

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10001 2002-11-16 Blastp of sequenced clone
CG10001 2003-01-01 Sim4 clustering to Release 3
AR-2 2008-04-29 Release 5.5 accounting
AR-2 2008-08-15 Release 5.9 accounting
AR-2 2008-12-18 5.12 accounting

Clone Sequence Records

RE51580.complete Sequence

2011 bp (2011 high quality bases) assembled on 2002-11-16

GenBank Submission: BT003199

> RE51580.complete
GGTTGGGCGCTGGATACGGACGCGAGCAGTGTGGACTATCGAATTGGCCA
AAAGCAGCAGTATAAAATCGAAAATATATAGCGTACCGCGGCGCAGCAGT
CGGTAGCAACAATAGGAACGTGGTTTTTTGGCCATAGCCTTATAGCCCCA
AAATTTATGCCGTTCGTTTGTCAATAAAAAAGCAAACGAGAAATGTAAAC
AGAAACGCAGCGAAAGGAAGACATCATATTGAATTTATGGTGTAGGTGCA
GCAACGTGGTCCTCGAACCTAAGGACACCCCGGTGTCCTTGTCGTCAGGG
TGTGACTCGGCACAGTTTGGCTGTGTCGGTGTCGTTTGCACGTGCCCTCA
CCTTTAAACTCACTCTCTTGCCTTTCGCCTCACCGTGATCCTTGTGTGCT
GTCCTTTATTGTTGTCTTACCTGTGCTACCCACCTACAATTACCGTTATC
GTGGAAGGACCAAATTGCTTTTGCCCCCGCCACGTTGCGAACAATTCCGG
TCGAGTTCGATACCACACGGCGTATGCGAAACGTTTTTGAGGTCTCCGAA
GCTCAACGGTCGTAGTATTCCGCATGATAATTGAATTTTTGTGGCGGCTG
CTTTGTGAAACTCTCCTAATTGGAAATTTGTTATTTGCGTTCGATGAACT
GTGAGCGAAAAAGAGCCCAAAATTGAAAATGTCCCGTGACAATCAAGCGA
AATCGCCAATAGCCAGTACAAAGTGAACCGGAAAGTTGTGCACTAAAGCT
GAGAAAACATGGAGAACACCACAATGCTGGCTAATATTAGCCTAAATGCA
ACCAGAAATGAGGAGAATATCACCTCATTCTTCACCGACGAAGAGTGGCT
GGCCATCAATGGCACTTTGCCGTGGATAGTGGGATTCTTCTTCGGCGTCA
TCGCCATCACGGGATTCTTCGGCAACCTGCTGGTCATCCTGGTGGTGGTC
TTCAACAACAACATGCGCTCCACCACCAACCTGATGATTGTCAATCTGGC
TGCCGCTGATCTGATGTTCGTAATCCTCTGCATTCCCTTCACGGCCACCG
ATTACATGGTGTACTACTGGCCATATGGAAGGTTCTGGTGCCGCAGTGTC
CAGTACCTGATTGTGGTGACCGCCTTCGCCTCCATTTACACGCTGGTGCT
GATGTCCATCGATCGGTTCCTGGCGGTGGTTCATCCCATTCGCTCGCGGA
TGATGAGGACGGAGAACATTACCCTGATTGCCATCGTGACTCTGTGGATC
GTGGTGCTGGTCGTTTCGGTGCCAGTGGCCTTCACCCACGACGTGGTGGT
GGATTACGATGCAAAGAAGAACATCACCTACGGCATGTGCACCTTCACGA
CGAACGACTTCCTTGGTCCGCGCACCTACCAGGTCACCTTCTTCATCAGC
TCCTACCTGCTGCCCCTGATGATCATCAGCGGTCTCTACATGCGCATGAT
CATGCGGCTCTGGCGCCAGGGAACCGGCGTCCGCATGTCCAAGGAGTCGC
AGCGCGGTCGCAAGCGGGTCACCCGACTCGTCGTCGTGGTGGTCATCGCC
TTCGCCTCGCTCTGGCTGCCTGTCCAGCTCATCCTGCTGCTCAAGTCACT
GGATGTCATCGAGACGAACACCCTCACCAAGCTAGTCATCCAGGTCACCG
CCCAGACTCTGGCCTACAGCAGCTCGTGTATCAATCCGCTGCTCTACGCC
TTCCTCTCCGAGAATTTCCGGAAGGCCTTCTACAAGGCCGTTAACTGCTC
CTCTCGATACCAGAACTACACATCTGATTTGCCGCCGCCGCGCAAGACGT
CCTGTGCCAGGACCTCCACCACTGGACTCTAAGGGTCAGCAAATCTTTGA
GGGCACAAGTGGATAAATACCCGGGACCAATCCATCAATGGACTGCAAGC
GACCGCTGCATTGGATTTTTGCTCTTCGAATGACTAGAGTTAAGATATAA
GGACTTTGTAAATATTGAATTAGATTAAATGAAATGCTTGTCTGTAAAAA
AAAAAAAAAAA

RE51580.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
AR-2-RA 2442 AR-2-RA 170..2164 2..1996 9975 100 Plus
AR-2.a 2525 AR-2.a 170..1905 2..1737 8680 100 Plus
AR-2.a 2525 AR-2.a 1988..2247 1737..1996 1300 100 Plus
AlstR-RB 3704 AlstR-RB 1084..1136 1135..1187 190 90.5 Plus
AlstR-RB 3704 AlstR-RB 879..1004 930..1055 180 76.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24566521..24567821 1300..2 6360 99.6 Minus
chr3R 27901430 chr3R 24563743..24564022 1577..1298 1385 99.6 Minus
chr3R 27901430 chr3R 24560423..24560683 1995..1735 1275 99.2 Minus
chr3R 27901430 chr3R 24563508..24563670 1737..1575 815 100 Minus
chrX 22417052 chrX 3549278..3549330 1135..1187 190 90.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28743484..28744782 1300..2 6495 100 Minus
3R 32079331 3R 28740706..28740985 1577..1298 1400 100 Minus
3R 32079331 3R 28737387..28737648 1996..1735 1310 100 Minus
3R 32079331 3R 28740471..28740633 1737..1575 815 100 Minus
X 23542271 X 3655852..3655904 1135..1187 190 90.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28484315..28485613 1300..2 6495 100 Minus
3R 31820162 3R 28481537..28481816 1577..1298 1400 100 Minus
3R 31820162 3R 28478218..28478479 1996..1735 1310 100 Minus
3R 31820162 3R 28481302..28481464 1737..1575 815 100 Minus
X 23527363 X 3663950..3664002 1135..1187 190 90.5 Plus
X 23527363 X 3663699..3663791 963..1055 165 78.4 Plus
Blast to na_te.dros performed on 2019-03-16 20:12:40 has no hits.

RE51580.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:13:27 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24566523..24567821 1..1298 99   Minus
chr3R 24560423..24560681 1737..1995 99 <- Minus
chr3R 24563509..24563667 1578..1736 100 <- Minus
chr3R 24563743..24564021 1299..1577 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:06 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1074 759..1832 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:03:47 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1074 759..1832 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:42 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1074 759..1832 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:54:01 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1074 759..1832 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:55:16 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AstA-R2-RA 1..1074 759..1832 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:22:30 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1345 651..1995 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:03:46 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1345 651..1995 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:42 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1994 2..1995 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:54:01 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AR-2-RA 1..1345 651..1995 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:55:16 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
AstA-R2-RA 1..1994 2..1995 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:13:27 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28737388..28737646 1737..1995 100 <- Minus
3R 28740472..28740630 1578..1736 100 <- Minus
3R 28740706..28740984 1299..1577 100 <- Minus
3R 28743486..28744782 1..1298 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:13:27 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28737388..28737646 1737..1995 100 <- Minus
3R 28740472..28740630 1578..1736 100 <- Minus
3R 28740706..28740984 1299..1577 100 <- Minus
3R 28743486..28744782 1..1298 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:13:27 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28737388..28737646 1737..1995 100 <- Minus
3R 28740472..28740630 1578..1736 100 <- Minus
3R 28740706..28740984 1299..1577 100 <- Minus
3R 28743486..28744782 1..1298 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:42 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24566194..24566352 1578..1736 100 <- Minus
arm_3R 24563110..24563368 1737..1995 100 <- Minus
arm_3R 24566428..24566706 1299..1577 100 <- Minus
arm_3R 24569208..24570504 1..1298 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:26:15 Download gff for RE51580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28481303..28481461 1578..1736 100 <- Minus
3R 28481537..28481815 1299..1577 100 <- Minus
3R 28478219..28478477 1737..1995 100 <- Minus
3R 28484317..28485613 1..1298 99   Minus

RE51580.pep Sequence

Translation from 758 to 1831

> RE51580.pep
MENTTMLANISLNATRNEENITSFFTDEEWLAINGTLPWIVGFFFGVIAI
TGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYM
VYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMR
TENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTND
FLGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQRG
RKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQT
LAYSSSCINPLLYAFLSENFRKAFYKAVNCSSRYQNYTSDLPPPRKTSCA
RTSTTGL*

RE51580.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16432-PA 359 GF16432-PA 1..359 1..357 1425 79.2 Plus
Dana\GF22643-PA 427 GF22643-PA 96..413 27..355 772 49.4 Plus
Dana\GF23626-PA 485 GF23626-PA 84..376 44..335 374 34 Plus
Dana\GF10462-PA 542 GF10462-PA 37..341 40..335 362 30.4 Plus
Dana\GF10817-PA 576 GF10817-PA 170..457 44..333 361 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12058-PA 357 GG12058-PA 1..357 1..357 1848 98.3 Plus
Dere\GG18661-PA 397 GG18661-PA 45..383 4..355 776 48.2 Plus
Dere\GG13659-PA 483 GG13659-PA 84..373 45..333 366 34.3 Plus
Dere\GG15739-PA 550 GG15739-PA 144..437 37..333 357 32.8 Plus
Dere\GG14129-PA 542 GG14129-PA 35..329 40..326 349 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14161-PA 302 GH14161-PA 11..302 66..357 1186 76.4 Plus
Dgri\GH24210-PA 436 GH24210-PA 118..422 40..355 764 51.1 Plus
Dgri\GH17108-PA 552 GH17108-PA 134..442 20..333 376 32.1 Plus
Dgri\GH22663-PA 552 GH22663-PA 134..442 20..333 376 32.1 Plus
Dgri\GH14454-PA 501 GH14454-PA 96..386 44..333 367 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
AstA-R2-PC 357 CG10001-PC 1..357 1..357 1826 100 Plus
AstA-R2-PA 357 CG10001-PA 1..357 1..357 1826 100 Plus
AstA-R2-PB 350 CG10001-PB 1..338 1..339 1661 97.1 Plus
AstA-R1-PD 394 CG2872-PD 63..380 27..355 816 49.5 Plus
AstA-R1-PB 394 CG2872-PB 63..380 27..355 816 49.5 Plus
AstC-R1-PA 483 CG7285-PA 84..373 45..333 408 34.8 Plus
AstC-R2-PE 549 CG13702-PE 141..437 34..333 400 32.8 Plus
AstC-R2-PB 549 CG13702-PB 141..437 34..333 400 32.8 Plus
AstC-R2-PD 567 CG13702-PD 141..437 34..333 400 32.8 Plus
AstC-R2-PF 593 CG13702-P2-RF 141..437 34..333 400 32.8 Plus
Lkr-PA 542 CG10626-PA 37..331 40..326 371 30.5 Plus
TkR99D-PB 517 CG7887-PB 96..392 37..324 365 28.7 Plus
TkR99D-PA 519 CG7887-PA 96..392 37..324 365 28.7 Plus
TkR99D-PC 564 CG7887-PC 96..392 37..324 365 28.7 Plus
SIFaR-PC 758 CG10823-PC 217..537 47..353 350 29.1 Plus
SIFaR-PA 758 CG10823-PA 217..537 47..353 350 29.1 Plus
NPFR-PA 485 CG1147-PA 84..392 38..331 328 28.1 Plus
NPFR-PD 489 CG1147-PD 84..392 38..331 328 28.1 Plus
sNPF-R-PB 600 CG7395-PB 70..416 45..336 328 25.2 Plus
sNPF-R-PA 600 CG7395-PA 70..416 45..336 328 25.2 Plus
TkR86C-PA 504 CG6515-PA 78..380 37..330 320 26.6 Plus
TkR86C-PB 555 CG6515-PB 78..380 37..330 320 26.6 Plus
NPFR-PC 462 CG1147-PC 84..381 38..321 317 27.8 Plus
NPFR-PB 466 CG1147-PB 84..381 38..321 317 27.8 Plus
RYa-R-PA 464 CG5811-PA 107..437 40..355 316 26.3 Plus
RYa-R-PC 467 CG5811-PC 107..399 40..329 314 26.2 Plus
RYa-R-PB 518 CG5811-PB 107..399 40..329 314 26.2 Plus
CCHa1-R-PA 499 CG30106-PA 56..383 15..330 312 25.3 Plus
CapaR-PB 477 CG14575-PB 70..367 40..324 307 27.3 Plus
CCHa2-R-PB 477 CG14593-PB 70..368 39..330 304 27 Plus
CCHa2-R-PA 489 CG14593-PA 70..368 39..330 304 27 Plus
CG30340-PA 396 CG30340-PA 28..316 34..326 296 28.5 Plus
TrissinR-PD 659 CG34381-PD 199..386 53..241 289 31.2 Plus
TrissinR-PE 664 CG34381-PE 199..386 53..241 289 31.2 Plus
TrissinR-PC 664 CG34381-PC 199..386 53..241 289 31.2 Plus
TrissinR-PB 669 CG34381-PB 199..386 53..241 289 31.2 Plus
Octbeta3R-PJ 445 CG42244-PJ 106..429 6..330 281 24.9 Plus
PK2-R1-PA 660 CG8784-PA 114..399 45..324 275 27.3 Plus
PK2-R2-PB 599 CG8795-PB 73..355 45..324 274 28.8 Plus
PK2-R2-PA 599 CG8795-PA 73..355 45..324 274 28.8 Plus
ETHR-PC 471 CG5911-PC 15..314 43..333 257 23.3 Plus
ETHR-PA 471 CG5911-PA 15..314 43..333 257 23.3 Plus
Octbeta1R-PC 428 CG6919-PC 106..422 37..331 255 23.6 Plus
Octbeta1R-PE 508 CG6919-PE 106..428 37..337 255 23.5 Plus
Octbeta1R-PA 508 CG6919-PA 106..428 37..337 255 23.5 Plus
Octbeta1R-PB 421 CG6919-PB 106..419 37..328 252 23.5 Plus
ETHR-PB 461 CG5911-PB 15..332 43..326 245 23.7 Plus
CapaR-PC 301 CG14575-PC 70..301 40..259 242 27.5 Plus
Dop1R1-PC 481 CG9652-PC 97..427 21..324 239 23.5 Plus
PK1-R-PE 430 CG9918-PE 27..361 45..328 236 24.6 Plus
PK1-R-PD 430 CG9918-PD 27..361 45..328 236 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10533-PA 365 GI10533-PA 17..365 7..357 1311 74.6 Plus
Dmoj\GI15835-PA 345 GI15835-PA 62..331 12..355 566 39.9 Plus
Dmoj\GI11711-PA 567 GI11711-PA 176..458 47..333 367 33.1 Plus
Dmoj\GI13590-PA 496 GI13590-PA 85..375 44..333 366 34.2 Plus
Dmoj\GI13186-PA 555 GI13186-PA 38..361 40..357 340 27.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13693-PA 357 GL13693-PA 1..357 1..357 1394 74 Plus
Dper\GL15947-PA 388 GL15947-PA 82..367 40..327 700 50 Plus
Dper\GL12071-PA 565 GL12071-PA 37..341 40..335 351 29.8 Plus
Dper\GL13493-PA 531 GL13493-PA 95..391 37..324 335 28.6 Plus
Dper\GL27160-PA 821 GL27160-PA 273..579 47..339 307 28.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10001-PA 357 GA10001-PA 1..357 1..357 1394 74 Plus
Dpse\GA15495-PA 400 GA15495-PA 82..386 40..355 758 50.9 Plus
Dpse\GA23907-PA 495 GA23907-PA 86..373 44..330 373 34.9 Plus
Dpse\GA23817-PB 512 GA23817-PB 37..341 40..335 351 29.8 Plus
Dpse\GA12470-PA 577 GA12470-PA 163..457 37..333 345 31.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12288-PA 357 GM12288-PA 1..357 1..357 1862 99.4 Plus
Dsec\GM12299-PA 394 GM12299-PA 63..380 27..355 769 49.5 Plus
Dsec\GM14973-PA 483 GM14973-PA 84..373 45..333 366 34.6 Plus
Dsec\GM14937-PA 548 GM14937-PA 143..436 37..333 359 32.8 Plus
Dsec\GM13917-PA 540 GM13917-PA 35..329 40..326 353 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18022-PA 357 GD18022-PA 1..357 1..357 1866 99.7 Plus
Dsim\GD16646-PA 394 GD16646-PA 63..380 27..355 769 49.5 Plus
Dsim\GD14751-PA 483 GD14751-PA 84..373 45..333 366 34.6 Plus
Dsim\GD12341-PA 532 GD12341-PA 143..420 37..333 355 32 Plus
Dsim\GD13194-PA 542 GD13194-PA 37..331 40..326 353 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24185-PA 369 GJ24185-PA 26..369 14..357 1343 74.9 Plus
Dvir\GJ19325-PA 424 GJ19325-PA 106..410 40..355 766 51.1 Plus
Dvir\GJ13930-PA 494 GJ13930-PA 82..372 44..333 362 33.9 Plus
Dvir\GJ11962-PA 543 GJ11962-PA 1..361 6..357 344 27.4 Plus
Dvir\GJ14245-PA 516 GJ14245-PA 87..430 12..336 331 28.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10988-PA 371 GK10988-PA 1..370 1..356 1287 70.1 Plus
Dwil\GK14796-PA 429 GK14796-PA 112..404 40..344 742 50.5 Plus
Dwil\GK17310-PA 577 GK17310-PA 34..328 40..326 364 30.5 Plus
Dwil\GK11187-PA 502 GK11187-PA 87..374 44..330 363 34.2 Plus
Dwil\GK11516-PA 591 GK11516-PA 174..460 44..333 363 33.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10499-PA 357 GE10499-PA 1..357 1..357 1860 99.2 Plus
Dyak\GE16306-PA 394 GE16306-PA 63..380 27..355 775 50.3 Plus
Dyak\GE19956-PA 483 GE19956-PA 83..373 44..333 366 34.4 Plus
Dyak\GE22071-PA 553 GE22071-PA 147..440 37..333 358 32.8 Plus
Dyak\GE20556-PA 558 GE20556-PA 35..329 40..326 353 30.5 Plus

RE51580.hyp Sequence

Translation from 758 to 1831

> RE51580.hyp
MENTTMLANISLNATRNEENITSFFTDEEWLAINGTLPWIVGFFFGVIAI
TGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYM
VYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMR
TENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTND
FLGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQRG
RKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQT
LAYSSSCINPLLYAFLSENFRKAFYKAVNCSSRYQNYTSDLPPPRKTSCA
RTSTTGL*

RE51580.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
AstA-R2-PC 357 CG10001-PC 1..357 1..357 1826 100 Plus
AstA-R2-PA 357 CG10001-PA 1..357 1..357 1826 100 Plus
AstA-R2-PB 350 CG10001-PB 1..338 1..339 1661 97.1 Plus
AstA-R1-PD 394 CG2872-PD 63..380 27..355 816 49.5 Plus
AstA-R1-PB 394 CG2872-PB 63..380 27..355 816 49.5 Plus