Clone RE51791 Report

Search the DGRC for RE51791

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:517
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCG8891-RA
Protein status:RE51791.pep: gold
Preliminary Size:576
Sequenced Size:783

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8891 2001-12-14 Blastp of sequenced clone
CG8891 2002-01-01 Sim4 clustering to Release 2
CG8891 2003-01-01 Sim4 clustering to Release 3
CG8891 2008-04-29 Release 5.5 accounting
CG8891 2008-08-15 Release 5.9 accounting
CG8891 2008-12-18 5.12 accounting

Clone Sequence Records

RE51791.complete Sequence

783 bp (783 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071428

> RE51791.complete
AAGCTAAGCAGAAAACAGCTGATTTGGCCGCATGCTTTAGTCTTGCAAAT
GGCGTTGAATACTGCGGCCAATTGTTTAAATTGAGGGCGACAATTTAATC
TGTACCGTCATGTCGAAACCAATTACCTTTGTCACCGGCAACGCCAAGAA
GCTGGAAGAGTTGGTTGCCATCCTGGGACCCAGTTTCCCGCGCACCATTG
TGTCAAAGAAGATTGATCTTCCGGAATTGCAAGGCGACATCGACGAGATT
GCCATCAAGAAGTGCAAGGAGGCAGCGCGTCAGGTGAATGGACCCGTGCT
GGTGGAGGACACTAGTCTGTGCTTCAATGCGCTGGAGGGCTTGCCGGGTC
CGTACATCAAATGGTTCCTGGAGAAGCTGCAGCCGGAGGGGTTACACCGT
CTGCTCCATGGTTGGGAGAACAAAAGCGCTCAGGCTATTTGCACCTTTGG
CTACTGCGACGGTGTGGATGCCGAGCCTCTAATCTTTAAGGGCATCACCG
AGGGCGTTATCGTCGAACCTCGCGGCCCCCGGGACTTTGGATGGGATCCG
GTTTTCCAGCCCAGTGGCTACGATAAGACCTACGCCGAACTGCCCAAGTC
CGAGAAGAACACCATTTCCCATCGCTACCGCGCTTTAGCTCTACTGCGGC
AGCACTTCGAGAAACAGGACAAGTTAATAAACTAGGACTCAATTTAATTT
AATTATTCAATTCAATTATTTAAACATCGCATATTTGTTCTACATTGTCG
AGAAGTTGTTGCAACCTAAAAAAAAAAAAAAAA

RE51791.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8891-RA 856 CG8891-RA 62..829 1..768 3840 100 Plus
CG3792-RA 1305 CG3792-RA 1220..1305 768..683 430 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4977875..4978187 544..232 1565 100 Minus
chr2L 23010047 chr2L 4978244..4978477 234..1 1170 100 Minus
chr2L 23010047 chr2L 4977584..4977808 767..543 1125 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4978775..4979087 544..232 1565 100 Minus
2L 23513712 2L 4979144..4979377 234..1 1170 100 Minus
2L 23513712 2L 4978483..4978708 768..543 1130 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4978775..4979087 544..232 1565 100 Minus
2L 23513712 2L 4979144..4979377 234..1 1170 100 Minus
2L 23513712 2L 4978483..4978708 768..543 1130 100 Minus
Blast to na_te.dros performed 2019-03-16 07:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy6 7826 gypsy6 GYPSY6 7826bp 933..979 709..757 113 75.5 Plus
412 7567 412 412 7567bp 5500..5569 662..731 107 61.4 Plus

RE51791.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:34:47 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4977584..4977807 544..767 100 <- Minus
chr2L 4977876..4978185 234..543 100 <- Minus
chr2L 4978245..4978477 1..233 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:15 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..576 110..685 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:22 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..576 110..685 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:32:33 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..576 110..685 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:19 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..576 110..685 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:54 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..576 110..685 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:15 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:22 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:32:33 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 3..769 1..767 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:19 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:54 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
CG8891-RA 3..769 1..767 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:47 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4978776..4979085 234..543 100 <- Minus
2L 4979145..4979377 1..233 100   Minus
2L 4978484..4978707 544..767 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:47 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4978776..4979085 234..543 100 <- Minus
2L 4979145..4979377 1..233 100   Minus
2L 4978484..4978707 544..767 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:47 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4978776..4979085 234..543 100 <- Minus
2L 4979145..4979377 1..233 100   Minus
2L 4978484..4978707 544..767 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:32:33 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4978484..4978707 544..767 100 <- Minus
arm_2L 4978776..4979085 234..543 100 <- Minus
arm_2L 4979145..4979377 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:50 Download gff for RE51791.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4978484..4978707 544..767 100 <- Minus
2L 4978776..4979085 234..543 100 <- Minus
2L 4979145..4979377 1..233 100   Minus

RE51791.hyp Sequence

Translation from 109 to 684

> RE51791.hyp
MSKPITFVTGNAKKLEELVAILGPSFPRTIVSKKIDLPELQGDIDEIAIK
KCKEAARQVNGPVLVEDTSLCFNALEGLPGPYIKWFLEKLQPEGLHRLLH
GWENKSAQAICTFGYCDGVDAEPLIFKGITEGVIVEPRGPRDFGWDPVFQ
PSGYDKTYAELPKSEKNTISHRYRALALLRQHFEKQDKLIN*

RE51791.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8891-PA 191 CG8891-PA 1..191 1..191 1015 100 Plus

RE51791.pep Sequence

Translation from 109 to 684

> RE51791.pep
MSKPITFVTGNAKKLEELVAILGPSFPRTIVSKKIDLPELQGDIDEIAIK
KCKEAARQVNGPVLVEDTSLCFNALEGLPGPYIKWFLEKLQPEGLHRLLH
GWENKSAQAICTFGYCDGVDAEPLIFKGITEGVIVEPRGPRDFGWDPVFQ
PSGYDKTYAELPKSEKNTISHRYRALALLRQHFEKQDKLIN*

RE51791.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14164-PA 191 GF14164-PA 1..189 1..189 887 88.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24330-PA 191 GG24330-PA 1..191 1..191 1006 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13806-PA 187 GH13806-PA 1..184 1..184 841 81.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG8891-PA 191 CG8891-PA 1..191 1..191 1015 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18056-PA 187 GI18056-PA 1..184 1..184 875 87 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26487-PA 188 GL26487-PA 1..187 1..187 915 89.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21395-PA 188 GA21395-PA 1..187 1..187 918 89.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18051-PA 191 GM18051-PA 1..191 1..191 1013 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22671-PA 191 GD22671-PA 1..191 1..191 1010 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22490-PA 188 GJ22490-PA 1..186 1..186 855 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24597-PA 187 GK24597-PA 1..187 1..187 872 85 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18710-PA 191 GE18710-PA 1..191 1..191 994 97.4 Plus