Clone RE51843 Report

Search the DGRC for RE51843

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:518
Well:43
Vector:pFlc-1
Associated Gene/Transcripthoip-RA
Protein status:RE51843.pep: gold
Sequenced Size:574

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2010-01-15 I'm sure there was a reason

Clone Sequence Records

RE51843.complete Sequence

574 bp assembled on 2010-01-18

GenBank Submission: BT120152.1

> RE51843.complete
AGTTGTTCTGCAATTGCCCTCAGTGAAGCAGCAAGCGGAGAGGTTGCATT
TTAAAGCACTTTTTTCCAGTAAAAGTATACAATAAACAAGCCAATATGAC
TGAGGAAGTTAATCCCAAGGCATTCCCGCTGGCCGATGCCCAGCTTACCG
CCAAGATCATGAACTTGCTGCAGCAAGCATTGAACTACAATCAACTGCGC
AAGGGAGCCAACGAGGCCACCAAGACCCTCAATCGCGGACTGGCCGATAT
TGTGGTGCTGGCCGGTGATGCGGAGCCCATCGAGATTCTGCTCCATTTGC
CGCTCCTGTGCGAGGACAAGAACGTGCCCTACGTCTTCGTTCGTTCCAAG
CAGGCCTTGGGGCGTGCGTGCGGAGTTTCCCGGCCAATAGTCGCCTGCTC
TGTGACCACCAACGAGGGCAGCCAGCTCAAGTCGCAGATCACCTCCATTC
AGCAGGAGATCGAGCGACTGCTAGTCTAGTAACCCTTTAGATTTGAGTGA
ACATTCGTACAAAGTGGTAATTTCAAATTGAAATTTTGAATAAACATGTG
TATTCTTTAAAAAAAAAAAAAAAA

RE51843.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-RA 733 hoip-RA 77..634 3..560 2775 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9698826..9699286 98..558 2290 99.8 Plus
chr2L 23010047 chr2L 9698669..9698764 3..98 480 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9699999..9700461 98..560 2300 99.8 Plus
2L 23513712 2L 9699842..9699937 3..98 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9699999..9700461 98..560 2300 99.7 Plus
2L 23513712 2L 9699842..9699937 3..98 480 100 Plus
Blast to na_te.dros performed 2019-03-16 18:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 4005..4054 557..508 106 68 Minus

RE51843.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:42:19 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9698667..9698764 1..98 98 -> Plus
chr2L 9698827..9699286 99..558 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-18 12:25:35 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 1..384 96..479 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:53:09 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 1..384 96..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:50:16 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 1..384 96..479 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:46:30 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 1..384 96..479 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-18 12:25:35 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 7..564 1..558 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:53:08 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 50..607 1..558 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:50:16 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 12..569 1..558 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:46:30 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 12..569 1..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:19 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9699840..9699937 1..98 98 -> Plus
2L 9700000..9700459 99..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:19 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9699840..9699937 1..98 98 -> Plus
2L 9700000..9700459 99..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:19 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9699840..9699937 1..98 98 -> Plus
2L 9700000..9700459 99..558 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:50:16 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9699840..9699937 1..98 98 -> Plus
arm_2L 9700000..9700459 99..558 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:25 Download gff for RE51843.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9700000..9700459 99..558 99   Plus
2L 9699840..9699937 1..98 98 -> Plus

RE51843.pep Sequence

Translation from 95 to 478

> RE51843.pep
MTEEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLA
DIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVA
CSVTTNEGSQLKSQITSIQQEIERLLV*

RE51843.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22789-PA 127 GF22789-PA 1..127 1..127 655 99.2 Plus
Dana\GF25179-PA 160 GF25179-PA 37..156 5..125 192 33.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10048-PA 127 GG10048-PA 1..127 1..127 659 100 Plus
Dere\GG13705-PA 160 GG13705-PA 37..156 5..125 192 33.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25137-PA 127 GH25137-PA 1..127 1..127 655 99.2 Plus
Dgri\GH14629-PA 160 GH14629-PA 37..158 5..127 191 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-PB 127 CG3949-PB 1..127 1..127 631 100 Plus
hoip-PA 127 CG3949-PA 1..127 1..127 631 100 Plus
NHP2-PB 160 CG5258-PB 37..156 5..125 194 35.2 Plus
NHP2-PA 160 CG5258-PA 37..156 5..125 194 35.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20000-PA 127 GI20000-PA 1..127 1..127 655 99.2 Plus
Dmoj\GI11341-PA 160 GI11341-PA 37..156 5..125 194 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18927-PA 147 GL18927-PA 22..147 2..127 648 99.2 Plus
Dper\GL24587-PA 160 GL24587-PA 37..158 5..127 191 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17798-PA 147 GA17798-PA 22..147 2..127 647 99.2 Plus
Dpse\GA18767-PA 160 GA18767-PA 37..158 5..127 191 33.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17636-PA 127 GM17636-PA 1..127 1..127 659 100 Plus
Dsec\GM24527-PA 160 GM24527-PA 37..156 5..125 197 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23622-PA 127 GD23622-PA 1..127 1..127 659 100 Plus
Dsim\GD12597-PA 178 GD12597-PA 37..174 5..125 169 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13428-PA 106 GJ13428-PA 1..106 22..127 544 98.1 Plus
Dvir\GJ11595-PA 160 GJ11595-PA 37..158 5..127 195 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24184-PA 127 GK24184-PA 1..127 1..127 643 96.9 Plus
Dwil\GK10536-PA 160 GK10536-PA 37..158 5..127 202 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18862-PA 127 GE18862-PA 1..127 1..127 659 100 Plus
Dyak\NHP2-PA 160 GE20000-PA 37..156 5..125 194 34.4 Plus

RE51843.hyp Sequence

Translation from 95 to 478

> RE51843.hyp
MTEEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLA
DIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVA
CSVTTNEGSQLKSQITSIQQEIERLLV*

RE51843.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-PB 127 CG3949-PB 1..127 1..127 631 100 Plus
hoip-PA 127 CG3949-PA 1..127 1..127 631 100 Plus
NHP2-PB 160 CG5258-PB 37..156 5..125 194 35.2 Plus
NHP2-PA 160 CG5258-PA 37..156 5..125 194 35.2 Plus