Clone RE51966 Report

Gene	Date	Evidence
CG18294	2001-12-14	Blastp of sequenced clone
CG12519	2002-01-01	Sim4 clustering to Release 2
CG12519	2003-01-01	Sim4 clustering to Release 3
CG18294	2008-04-29	Release 5.5 accounting
CG18294	2008-08-15	Release 5.9 accounting
CG18294	2008-12-18	5.12 accounting

Clone Sequence Records

RE51966.complete Sequence

523 bp (523 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071430

> RE51966.complete
ATCAGACAAGTTCAAGTTTTCGAACCGTAAGCACCAGATCCATAATCATA
ATGTTCAAATCCGCCGTTGTTATTCTGGCTATCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTTCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCTTACTCAGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTTATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCCGCTCCTGTGGTGG
CCAAGTACGCTGCTGCTCCATTGGCCGCTCCTGTGGTGGCCAAGTACGCT
GCTGCTCCATTGGCTGCTCCTGTTGTGGCCAAGTACGCTGCTGCTCCATT
GGCCCACATTTCCTCCTTGGCTTACACCTCGCCTTTGGCATACAGTGCCT
TGCCATCAGCTCCTGTTCTTCTTTAGAAAACTTTAAAAGTAATAAAAAAA
ATCAAAGAAAAAAAAAAAAAAAA

RE51966.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:54

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG18294-RA	503	CG18294-RA	1..503	1..503	2515	100	Plus
CG12519-RA	747	CG12519-RA	192..549	1..358	1730	98.8	Plus
CG33255-RA	768	CG33255-RA	225..420	83..278	725	91.3	Plus
CG33255-RA	768	CG33255-RA	77..176	280..181	320	88	Minus
CG12519-RA	747	CG12519-RA	466..549	314..397	315	91.6	Plus
CG33255-RA	768	CG33255-RA	566..645	193..272	310	92.5	Plus
CG33255-RA	768	CG33255-RA	634..675	363..404	165	92.8	Plus
CG33255-RA	768	CG33255-RA	637..675	288..326	165	94.8	Plus
CG33255-RA	768	CG33255-RA	637..674	327..364	160	94.7	Plus
CG33255-RA	768	CG33255-RA	520..572	90..142	145	84.9	Plus

Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:30:34

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
chr3L	24539361	chr3L	19464437..19464880	506..63	2220	100	Minus
chr3L	24539361	chr3L	19462033..19462328	63..358	1420	98.6	Plus
chr3L	24539361	chr3L	19456121..19456383	326..64	1255	98.5	Minus
chr3L	24539361	chr3L	19465394..19465682	73..367	760	84.7	Plus
chr3L	24539361	chr3L	19461231..19461519	367..73	745	84.4	Minus
chr3L	24539361	chr3L	19456903..19457109	73..297	730	89.3	Plus
chr3L	24539361	chr3L	19413274..19413469	83..278	725	91.3	Plus
chr3L	24539361	chr3L	19467798..19467993	83..278	710	90.8	Plus
chr3L	24539361	chr3L	19477480..19477714	83..326	630	84.8	Plus
chr3L	24539361	chr3L	19464579..19464668	403..314	375	94.4	Minus
chr3L	24539361	chr3L	19464540..19464629	364..275	375	94.4	Minus
chr3L	24539361	chr3L	19412550..19412649	280..181	320	88	Minus
chr3L	24539361	chr3L	19456439..19456501	63..1	315	100	Minus
chr3L	24539361	chr3L	19461916..19461978	1..63	315	100	Plus
chr3L	24539361	chr3L	19462245..19462328	314..397	315	91.7	Plus
chr3L	24539361	chr3L	19464935..19464997	63..1	315	100	Minus
chr3L	24539361	chr3L	19414163..19414242	193..272	310	92.5	Plus
chr3L	24539361	chr3L	19461240..19461326	397..311	255	86.2	Minus
chr3L	24539361	chr3L	19465587..19465673	311..397	255	86.2	Plus
chr3L	24539361	chr3L	19453846..19453931	277..192	220	83.7	Minus
chr3L	24539361	chr3L	19412803..19412856	63..10	210	92.6	Minus
chr3L	24539361	chr3L	19467329..19467382	63..10	210	92.6	Minus
chr3L	24539361	chr3L	19476596..19476649	63..10	210	92.6	Minus
chr3L	24539361	chr3L	19456081..19456172	444..353	190	80.4	Minus
chr3L	24539361	chr3L	19464539..19464590	326..275	185	90.4	Minus
chr3L	24539361	chr3L	19464617..19464668	404..353	185	90.4	Minus
chr3L	24539361	chr3L	19414231..19414272	363..404	180	95.2	Plus
chr3L	24539361	chr3L	19414234..19414272	288..326	180	97.4	Plus
chr3L	24539361	chr3L	19462245..19462295	353..403	180	90.2	Plus

Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:01:08

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CR32205-RA	1085	CR32205-RA	140..335	278..83	725	91.3	Minus
pncr009:3L-RA	961	CR33940-RA	202..344	225..83	430	86.7	Minus
pncr009:3L-RA	961	CR33940-RA	110..203	326..233	320	89.3	Minus
CR32205-RA	1085	CR32205-RA	699..798	181..280	320	88	Plus
CR32205-RA	1085	CR32205-RA	547..649	10..112	305	86.4	Plus
pncr009:3L-RA	961	CR33940-RA	548..605	10..67	215	91.3	Plus
pncr009:3L-RA	961	CR33940-RA	110..151	404..363	150	90.4	Minus
pncr009:3L-RA	961	CR33940-RA	111..148	364..327	145	92.1	Minus
pncr009:3L-RA	961	CR33940-RA	739..787	249..297	140	85.7	Plus

Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:32

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28110227	3L	19475014..19475457	506..63	2220	100	Minus
3L	28110227	3L	19472610..19472905	63..358	1420	98.6	Plus
3L	28110227	3L	19466699..19466962	326..63	1260	98.5	Minus
3L	28110227	3L	19471808..19472096	367..73	745	84.4	Minus
3L	28110227	3L	19475971..19476259	73..367	745	84.4	Plus
3L	28110227	3L	19478373..19478568	83..278	740	91.8	Plus
3L	28110227	3L	19423849..19424044	83..278	725	91.3	Plus
3L	28110227	3L	19467481..19467687	73..297	700	88.4	Plus
3L	28110227	3L	19488045..19488279	83..326	615	84.4	Plus
3L	28110227	3L	19475117..19475206	364..275	375	94.4	Minus
3L	28110227	3L	19475156..19475245	403..314	375	94.4	Minus
3L	28110227	3L	19423125..19423224	280..181	320	88	Minus
3L	28110227	3L	19467017..19467079	63..1	315	100	Minus
3L	28110227	3L	19472493..19472555	1..63	315	100	Plus
3L	28110227	3L	19472822..19472905	314..397	315	91.7	Plus
3L	28110227	3L	19475512..19475574	63..1	315	100	Minus
3L	28110227	3L	19424757..19424836	193..272	310	92.5	Plus
3L	28110227	3L	19471817..19471903	397..311	255	86.2	Minus
3L	28110227	3L	19476164..19476250	311..397	255	86.2	Plus
3L	28110227	3L	19464433..19464518	277..192	220	83.7	Minus
3L	28110227	3L	19423378..19423431	63..10	210	92.6	Minus
3L	28110227	3L	19477906..19477959	63..10	210	92.6	Minus
3L	28110227	3L	19487161..19487214	63..10	210	92.6	Minus
3L	28110227	3L	19475116..19475167	326..275	185	90.4	Minus
3L	28110227	3L	19475194..19475245	404..353	185	90.4	Minus
3L	28110227	3L	19472822..19472872	353..403	180	90.2	Plus

Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:24

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28103327	3L	19468114..19468557	506..63	2220	100	Minus
3L	28103327	3L	19465710..19466005	63..358	1420	98.6	Plus
3L	28103327	3L	19459799..19460062	326..63	1260	98.4	Minus
3L	28103327	3L	19471473..19471668	83..278	740	91.8	Plus
3L	28103327	3L	19416949..19417144	83..278	725	91.3	Plus
3L	28103327	3L	19469117..19469277	137..297	670	94.4	Plus
3L	28103327	3L	19460627..19460787	137..297	670	94.4	Plus
3L	28103327	3L	19464990..19465150	297..137	670	94.4	Minus
3L	28103327	3L	19481145..19481287	83..225	430	86.7	Plus
3L	28103327	3L	19469071..19469159	73..161	400	96.6	Plus
3L	28103327	3L	19460581..19460669	73..161	400	96.6	Plus
3L	28103327	3L	19465108..19465196	161..73	400	96.6	Minus
3L	28103327	3L	19481286..19481379	233..326	320	89.3	Plus
3L	28103327	3L	19416225..19416324	280..181	320	88	Minus
3L	28103327	3L	19465922..19466005	314..397	315	91.6	Plus
3L	28103327	3L	19468612..19468674	63..1	315	100	Minus
3L	28103327	3L	19460117..19460179	63..1	315	100	Minus
3L	28103327	3L	19465593..19465655	1..63	315	100	Plus
3L	28103327	3L	19417857..19417936	193..272	310	92.5	Plus
3L	28103327	3L	19469264..19469350	311..397	255	86.2	Plus
3L	28103327	3L	19464917..19465003	397..311	255	86.2	Minus
3L	28103327	3L	19469267..19469359	275..367	240	83.8	Plus
3L	28103327	3L	19464908..19465000	367..275	240	83.8	Minus
3L	28103327	3L	19457533..19457618	277..192	220	83.7	Minus
3L	28103327	3L	19471006..19471059	63..10	210	92.5	Minus
3L	28103327	3L	19480261..19480314	63..10	210	92.5	Minus
3L	28103327	3L	19416478..19416531	63..10	210	92.5	Minus
3L	28103327	3L	19465922..19465972	353..403	180	90.1	Plus
3L	28103327	3L	19417928..19417966	288..326	165	94.8	Plus
3L	28103327	3L	19417925..19417966	363..404	165	92.8	Plus
3L	28103327	3L	19460774..19460830	311..367	165	85.9	Plus
3L	28103327	3L	19470855..19470938	159..76	165	79.7	Minus
3L	28103327	3L	19459806..19459850	358..314	165	91.1	Minus
3L	28103327	3L	19417928..19417965	327..364	160	94.7	Plus
3L	28103327	3L	19459759..19459850	444..353	160	78.2	Minus
3L	28103327	3L	19481338..19481379	363..404	150	90.4	Plus
3L	28103327	3L	19460774..19460821	350..397	150	87.5	Plus
3L	28103327	3L	19481341..19481378	327..364	145	92.1	Plus
3L	28103327	3L	19417811..19417863	90..142	145	84.9	Plus
3L	28103327	3L	19459760..19459811	170..119	140	84.6	Minus
3L	28103327	3L	19480020..19480068	297..249	140	85.7	Minus

Blast to na_te.dros performed 2019-03-15 16:30:32

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\TART	8500	Dvir\TART TARTVIR 8500bp	2777..2849	211..136	147	69.7	Minus

RE51966.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:31:47 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
chr3L	19464435..19464880	63..507	99	<-	Minus
chr3L	19464936..19464997	1..62	100		Minus

Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:24 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..426	51..476	100		Plus

Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:06 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..426	51..476	100		Plus

Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:03:45 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..426	51..476	100		Plus

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:15 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..426	51..476	100		Plus

Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:28 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..426	51..476	100		Plus

Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:09 has no hits.

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:13 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..503	1..503	100		Plus

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:06 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..503	1..503	100		Plus

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:03:45 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	5..507	1..503	100		Plus

Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:15 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	1..503	1..503	100		Plus

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:28 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
CG18294-RA	5..507	1..503	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:31:47 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19475012..19475457	63..507	99	<-	Minus
3L	19475513..19475574	1..62	100		Minus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:31:47 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19475012..19475457	63..507	99	<-	Minus
3L	19475513..19475574	1..62	100		Minus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:31:47 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19475012..19475457	63..507	99	<-	Minus
3L	19475513..19475574	1..62	100		Minus

Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:03:45 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
arm_3L	19468112..19468557	63..507	99	<-	Minus
arm_3L	19468613..19468674	1..62	100		Minus

Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:52 Download gff for RE51966.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	19468112..19468557	63..507	99	<-	Minus
3L	19468613..19468674	1..62	100		Minus

RE51966.hyp Sequence

Translation from 2 to 475

> RE51966.hyp
QTSSSFRTVSTRSIIIMFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAY
SAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAAAPVIAPVAAPVVA
KYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLAYSAL
PSAPVLL*

RE51966.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:08

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG18294-PA	141	CG18294-PA	1..141	17..157	678	100	Plus
CG12519-PB	131	CG12519-PB	1..131	17..157	560	85.8	Plus
CG12519-PA	131	CG12519-PA	1..131	17..157	560	85.8	Plus
CG14096-PA	122	CG14096-PA	1..122	17..157	486	76.8	Plus
825-Oak-PB	129	CG32208-PB	1..129	17..157	478	75.9	Plus

RE51966.pep Sequence

Translation from 50 to 475

> RE51966.pep
MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYA
AAPLAAPVVAKYAAAPLAHISSLAYTSPLAYSALPSAPVLL*

RE51966.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:20:00

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dana\GF23675-PA	108	GF23675-PA	1..108	1..141	274	68.8	Plus
Dana\GF23677-PA	132	GF23677-PA	1..111	1..99	230	80.2	Plus
Dana\GF23676-PA	120	GF23676-PA	1..120	1..140	189	69.3	Plus
Dana\GF10759-PA	139	GF10759-PA	1..131	1..95	185	58.4	Plus
Dana\GF23674-PA	140	GF23674-PA	1..62	1..68	185	86.8	Plus

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:20:00

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dere\GG13407-PA	135	GG13407-PA	1..75	1..86	305	84.9	Plus
Dere\GG13406-PA	105	GG13406-PA	1..69	1..86	271	76.7	Plus
Dere\GG16035-PA	121	GG16035-PA	1..69	1..86	270	76.7	Plus
Dere\GG13408-PA	155	GG13408-PA	43..155	18..141	188	70.4	Plus
Dere\GG16036-PA	119	GG16036-PA	1..119	1..141	183	75.9	Plus

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:20:01

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dgri\GH22598-PA	118	GH22598-PA	1..116	1..129	196	66.7	Plus
Dgri\GH24646-PA	120	GH24646-PA	1..120	1..141	185	65.5	Plus
Dgri\GH22595-PA	129	GH22595-PA	1..129	1..123	184	44.5	Plus
Dgri\GH22599-PA	120	GH22599-PA	1..120	1..141	181	66.9	Plus
Dgri\GH22596-PA	120	GH22596-PA	1..120	1..141	181	66.9	Plus

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:49

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
CG18294-PA	141	CG18294-PA	1..141	1..141	678	100	Plus
CG12519-PB	131	CG12519-PB	1..131	1..141	560	85.8	Plus
CG12519-PA	131	CG12519-PA	1..131	1..141	560	85.8	Plus
CG14096-PA	122	CG14096-PA	1..122	1..141	486	76.8	Plus
825-Oak-PB	129	CG32208-PB	1..129	1..141	478	75.9	Plus
CG32213-PB	129	CG32213-PB	1..129	1..141	475	75.2	Plus
CG32214-PC	116	CG32214-PC	1..116	1..141	429	71.6	Plus
CG32214-PB	116	CG32214-PB	1..116	1..141	429	71.6	Plus
CG32212-PA	111	CG32212-PA	1..107	1..115	307	66.1	Plus
CG14095-PA	162	CG14095-PA	1..161	1..140	292	47.7	Plus
CG13068-PA	109	CG13068-PA	1..109	1..129	205	47	Plus
Cpr64Ad-PB	247	CG1259-PB	27..137	16..122	198	50.8	Plus
CG13674-PB	137	CG13674-PB	5..135	5..141	194	43.4	Plus
CG13674-PA	137	CG13674-PA	5..135	5..141	194	43.4	Plus
CG13678-PA	128	CG13678-PA	1..126	1..141	190	45.3	Plus
CG13047-PB	170	CG13047-PB	5..170	6..141	190	37.4	Plus
CG13044-PA	155	CG13044-PA	1..143	1..140	174	40.4	Plus
CG13069-PA	97	CG13069-PA	1..96	1..111	172	45.3	Plus
CG13679-PB	119	CG13679-PB	5..117	5..141	170	43.9	Plus
CG13049-PA	181	CG13049-PA	75..172	10..116	160	46.8	Plus
CG13066-PB	93	CG13066-PB	6..88	5..105	148	43.7	Plus
CG34205-PA	217	CG34205-PA	26..183	6..136	140	33.3	Plus
CG13049-PA	181	CG13049-PA	3..130	5..139	139	37.5	Plus
CG13043-PA	148	CG13043-PA	1..144	1..133	138	37.2	Plus
CG13063-PA	129	CG13063-PA	1..127	1..133	137	35.8	Plus

Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:20:02

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dmoj\GI11789-PA	104	GI11789-PA	1..98	1..133	225	56.4	Plus
Dmoj\GI13530-PA	164	GI13530-PA	35..97	1..68	147	75	Plus
Dmoj\GI11787-PA	161	GI11787-PA	1..160	1..140	134	42.9	Plus

Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:20:02

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dper\GL20932-PA	139	GL20932-PA	1..56	1..68	204	67.6	Plus
Dper\GL20934-PA	62	GL20934-PA	1..55	1..67	153	56.7	Plus

Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:20:03

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dpse\GA28229-PA	126	GA28229-PA	1..126	1..141	155	57	Plus
Dpse\GA28633-PA	187	GA28633-PA	1..56	1..68	149	69.1	Plus
Dpse\GA28232-PA	151	GA28232-PA	1..60	1..76	141	55.3	Plus

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:20:03

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsec\GM19525-PA	182	GM19525-PA	93..182	46..141	160	68	Plus
Dsec\GM18729-PA	154	GM18729-PA	1..129	1..114	142	49.3	Plus

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:20:03

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsim\GD12281-PA	135	GD12281-PA	1..135	1..141	274	78.1	Plus
Dsim\GD12284-PA	170	GD12284-PA	36..103	1..68	187	94.1	Plus
Dsim\GD14803-PA	55	GD14803-PA	14..52	55..93	133	79.5	Plus

Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:20:04

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\GJ13492-PA	122	GJ13492-PA	1..93	1..96	172	71.4	Plus

Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:20:05

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dwil\GK19512-PA	138	GK19512-PA	1..122	1..131	189	57.1	Plus
Dwil\GK19490-PA	142	GK19490-PA	1..126	1..131	189	54.5	Plus
Dwil\GK20211-PA	128	GK20211-PA	1..128	1..141	188	54.1	Plus
Dwil\GK20204-PA	142	GK20204-PA	1..126	1..131	187	57.6	Plus
Dwil\GK20194-PA	142	GK20194-PA	1..126	1..131	186	52.3	Plus

Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:20:05

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dyak\GE15121-PA	142	GE15121-PA	26..142	1..141	197	73.8	Plus
Dyak\GE23008-PA	147	GE23008-PA	26..107	1..86	194	87.2	Plus
Dyak\GE22502-PA	117	GE22502-PA	1..117	1..141	186	66	Plus
Dyak\GE22503-PA	130	GE22503-PA	1..125	1..137	167	71.5	Plus

Library:	RE
Tissue Source:	Drosophila melanogaster embryo
Created by:	Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:	2000-10-23
Comments:	Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:	519
Well:	66
Vector:	pFlc-1
Associated Gene/Transcript	CG18294-RA
Protein status:	RE51966.pep: gold
Preliminary Size:	426
Sequenced Size:	523

Clone RE51966 Report

Clone and Library Details

Associated Genes

Clone Sequence Records

RE51966.complete Sequence

RE51966.complete Blast Records

RE51966.complete Sim4 Records

RE51966.hyp Sequence

RE51966.hyp Blast Records

RE51966.pep Sequence

RE51966.pep Blast Records