Clone RE52090 Report

Search the DGRC for RE52090

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:520
Well:90
Vector:pFlc-1
Associated Gene/TranscriptSod-RA
Protein status:RE52090.pep: gold
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11793 2001-12-14 Blastp of sequenced clone
CG11793 2002-01-01 Sim4 clustering to Release 2
CG11793 2003-01-01 Sim4 clustering to Release 3
Sod 2008-04-29 Release 5.5 accounting
Sod 2008-08-15 Release 5.9 accounting
Sod 2008-12-18 5.12 accounting

Clone Sequence Records

RE52090.complete Sequence

747 bp (747 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071435

> RE52090.complete
ATGTGTTTCTAAGCTGCTCTGCTACGGTCACACCATAGAAGATACCTGGA
AAGTTCTCAACTTTTTTCGTTTTGATAAATTGATTAATTCATTCGAAATG
GTGGTTAAAGCTGTCTGCGTAATTAACGGCGATGCCAAGGGCACGGTTTT
CTTCGAACAGGAGAGCAGCGGTACGCCCGTGAAGGTCTCCGGTGAGGTGT
GCGGCCTGGCCAAGGGTCTGCACGGATTCCACGTGCACGAGTTCGGTGAC
AACACCAATGGCTGCATGTCGTCCGGACCGCACTTCAATCCGTATGGCAA
GGAGCATGGCGCTCCCGTCGACGAGAATCGTCACCTGGGCGATCTGGGCA
ACATTGAGGCCACCGGCGACTGCCCCACCAAGGTCAACATCACCGACTCC
AAGATTACGCTCTTCGGCGCCGACAGCATCATCGGACGCACCGTTGTCGT
GCACGCCGATGCCGATGATCTTGGCCAGGGTGGACACGAGCTGAGCAAGT
CAACGGGCAACGCTGGTGCCCGCATCGGGTGCGGCGTTATTGGCATTGCC
AAGGTCTAAGCGATAATCTATTCCGATGTCGGCCACTGTGCTGATCTACT
CTATTTAGCACTACCCACTGGAGATATACAAACGATATACATACTTCTAA
ACATAAATACATAGCCTGTGGTCTGTTAGTTGATACGCAACCTTTGAGGT
TCAATAAATTGGTGTTTTGAAATTGCCCCATAAAAAAAAAAAAAAAA

RE52090.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Sod-RA 840 Sod-RA 100..838 1..739 3665 99.7 Plus
Sod.a 730 Sod.a 3..730 1..733 3550 99.1 Plus
Sod.b 777 Sod.b 208..777 164..733 2850 100 Plus
Sod.b 777 Sod.b 3..165 1..163 800 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11103156..11103725 731..162 2805 99.5 Minus
chr3L 24539361 chr3L 11104449..11104611 163..1 800 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11112273..11112850 739..162 2875 99.8 Minus
3L 28110227 3L 11113574..11113736 163..1 800 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11105373..11105950 739..162 2875 99.8 Minus
3L 28103327 3L 11106674..11106836 163..1 800 99.3 Minus
Blast to na_te.dros performed on 2019-03-16 21:16:05 has no hits.

RE52090.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:16:43 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11103156..11103723 164..731 99 <- Minus
chr3L 11104449..11104611 1..163 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:37 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 1..462 98..559 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:58 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 1..462 98..559 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:00 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 1..462 98..559 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:34 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 1..462 98..559 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:12:35 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 1..462 98..559 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:34 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 3..733 1..731 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:58 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 3..733 1..731 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:00 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 5..735 1..731 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:34 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 3..733 1..731 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:12:35 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
Sod-RA 5..735 1..731 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:43 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11112281..11112848 164..731 100 <- Minus
3L 11113574..11113736 1..163 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:43 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11112281..11112848 164..731 100 <- Minus
3L 11113574..11113736 1..163 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:43 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11112281..11112848 164..731 100 <- Minus
3L 11113574..11113736 1..163 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:00 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11105381..11105948 164..731 100 <- Minus
arm_3L 11106674..11106836 1..163 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:36 Download gff for RE52090.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11105381..11105948 164..731 100 <- Minus
3L 11106674..11106836 1..163 99   Minus

RE52090.hyp Sequence

Translation from 1 to 558

> RE52090.hyp
CISKLLCYGHTIEDTWKVLNFFRFDKLINSFEMVVKAVCVINGDAKGTVF
FEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGK
EHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVV
HADADDLGQGGHELSKSTGNAGARIGCGVIGIAKV*

RE52090.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Sod-PA 153 CG11793-PA 1..153 33..185 818 100 Plus
Sod-PD 167 CG11793-PD 1..167 33..185 793 91.6 Plus
Sod3-PA 181 CG9027-PA 40..180 42..182 374 55.3 Plus
Sod3-PB 181 CG9027-PB 40..180 42..182 374 55.3 Plus
Sod3-PD 217 CG9027-PD 40..180 42..182 374 55.3 Plus

RE52090.pep Sequence

Translation from 97 to 558

> RE52090.pep
MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFG
DNTNGCMSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITD
SKITLFGADSIIGRTVVVHADADDLGQGGHELSKSTGNAGARIGCGVIGI
AKV*

RE52090.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24570-PA 153 GF24570-PA 1..153 1..153 744 93.5 Plus
Dana\GF18703-PA 124 GF18703-PA 10..124 39..153 535 88.7 Plus
Dana\GF12396-PA 210 GF12396-PA 23..173 1..150 365 51 Plus
Dana\GF11145-PA 263 GF11145-PA 91..225 14..148 269 44.9 Plus
Dana\GF16781-PA 267 GF16781-PA 110..245 15..150 154 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Sod-PA 153 GG13936-PA 1..153 1..153 765 97.4 Plus
Dere\GG22650-PA 181 GG22650-PA 40..180 10..150 354 54.6 Plus
Dere\GG25230-PA 264 GG25230-PA 116..226 37..148 262 48.2 Plus
Dere\GG11434-PA 270 GG11434-PA 110..245 15..150 146 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14640-PA 153 GH14640-PA 1..153 1..153 673 86.3 Plus
Dgri\GH20507-PA 181 GH20507-PA 40..180 10..150 351 54.6 Plus
Dgri\GH11755-PA 181 GH11755-PA 40..180 10..150 350 54.6 Plus
Dgri\GH19972-PA 285 GH19972-PA 137..248 37..149 254 47.8 Plus
Dgri\GH22309-PA 256 GH22309-PA 104..240 13..150 159 31.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Sod1-PA 153 CG11793-PA 1..153 1..153 818 100 Plus
Sod1-PD 167 CG11793-PD 1..167 1..153 793 91.6 Plus
Sod3-PF 181 CG9027-PF 40..180 10..150 374 55.3 Plus
Sod3-PA 181 CG9027-PA 40..180 10..150 374 55.3 Plus
Sod3-PB 181 CG9027-PB 40..180 10..150 374 55.3 Plus
Sod3-PD 217 CG9027-PD 40..180 10..150 374 55.3 Plus
Sod3-PE 243 CG9027-PE 40..180 10..150 374 55.3 Plus
Ccs-PC 258 CG17753-PC 84..220 9..148 281 44.4 Plus
Ccs-PB 264 CG17753-PB 90..226 9..148 281 44.4 Plus
CG5948-PB 269 CG5948-PB 109..244 15..150 151 28.9 Plus
CG5948-PA 270 CG5948-PA 110..245 15..150 151 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11624-PA 153 GI11624-PA 1..153 1..153 681 86.9 Plus
Dmoj\GI21051-PA 181 GI21051-PA 40..180 10..150 346 52.5 Plus
Dmoj\GI20259-PA 236 GI20259-PA 115..219 37..142 224 45.4 Plus
Dmoj\GI22979-PA 271 GI22979-PA 97..247 4..150 153 28.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\Sod-PA 152 GL22843-PA 1..152 2..153 704 88.8 Plus
Dper\GL10397-PA 277 GL10397-PA 26..180 3..150 344 49.7 Plus
Dper\GL20081-PA 263 GL20081-PA 118..225 40..148 258 48.6 Plus
Dper\GL21798-PA 267 GL21798-PA 111..246 15..150 158 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Sod-PA 152 GA11202-PA 1..152 2..153 704 88.8 Plus
Dpse\GA30465-PB 181 GA30465-PB 26..180 3..150 344 49.7 Plus
Dpse\GA30465-PA 258 GA30465-PA 26..180 3..150 344 49.7 Plus
Dpse\GA14646-PA 263 GA14646-PA 118..225 40..148 258 48.6 Plus
Dpse\GA19252-PA 266 GA19252-PA 110..245 15..150 159 31.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Sod-PA 153 GM24771-PA 1..153 1..153 787 100 Plus
Dsec\GM20432-PA 181 GM20432-PA 40..180 10..150 350 54.6 Plus
Dsec\GM20549-PA 264 GM20549-PA 116..226 37..148 258 47.4 Plus
Dsec\GM10274-PA 270 GM10274-PA 110..245 15..150 155 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Sod-PA 153 GD12822-PA 1..153 1..153 787 100 Plus
Dsim\GD25903-PA 181 GD25903-PA 40..180 10..150 350 53.9 Plus
Dsim\GD26004-PA 264 GD26004-PA 116..226 37..148 258 47.4 Plus
Dsim\GD21244-PA 270 GD21244-PA 110..245 15..150 155 31.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Sod-PA 153 GJ11304-PA 1..153 1..153 677 86.9 Plus
Dvir\GJ21975-PA 181 GJ21975-PA 40..180 10..150 345 52.5 Plus
Dvir\GJ20212-PA 263 GJ20212-PA 115..225 37..148 252 47.4 Plus
Dvir\GJ24673-PA 268 GJ24673-PA 105..244 10..150 148 27.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Sod-PA 153 GK20556-PA 1..153 1..153 690 87.6 Plus
Dwil\GK21886-PA 181 GK21886-PA 40..180 10..150 353 53.2 Plus
Dwil\GK13564-PA 157 GK13564-PA 37..153 10..126 261 49.6 Plus
Dwil\GK12866-PA 257 GK12866-PA 99..197 12..125 144 30.7 Plus
Dwil\GK23033-PA 252 GK23033-PA 92..215 14..149 142 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Sod-PA 153 GE20235-PA 1..153 1..153 768 97.4 Plus
Dyak\GE13524-PA 181 GE13524-PA 40..180 10..150 351 53.9 Plus
Dyak\GE21764-PA 264 GE21764-PA 116..227 37..149 264 47 Plus
Dyak\GE23628-PA 270 GE23628-PA 110..245 15..150 151 30.5 Plus