BDGP Sequence Production Resources |
Search the DGRC for RE52392
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 523 |
Well: | 92 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG7394-RA |
Protein status: | RE52392.pep: gold |
Preliminary Size: | 387 |
Sequenced Size: | 544 |
Gene | Date | Evidence |
---|---|---|
CG7394 | 2001-12-14 | Blastp of sequenced clone |
CG7394 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7394 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7394 | 2008-04-29 | Release 5.5 accounting |
CG7394 | 2008-08-15 | Release 5.9 accounting |
CG7394 | 2008-12-18 | 5.12 accounting |
544 bp (544 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071438
> RE52392.complete AGCTGACAGCAGGCTATGCAGTTCCACTGACTTACAGCTGTTAAAATTAC ATAAAAATGGCGAGCTCCGTAATTCTGGCGGGTCTTAGCGTGGCCGCCGT GGGATTCGCCGGAAAGCACCTGATGCGCCGCATGCCCCAGATGACCACCA AATTCAACGAGGCCCTCAAGAACCTGCCCAAATACGATGCGGAGAGCATG GCCGCCTCCAAATACTACAAGGGCGGCTTCGATCCCAAGATGAACAAGCG GGAGGCGTCCCTAATCCTAGGTGTCAGCCCCAGTGCGTCCAAGATAAAGA TTAAGGACGCGCACAAGAAGATCATGCTGTTGAACCATCCGGATCGAGGA GGATCTCCCTATTTGGCGGCCAAGATCAACGAGGCCAAAGACTTTCTGGA CAAAGCGAAGTAGTCATCCTCTCCCCGCCGTTCAGTGCAAATAAAGTAGT AGTTCGTGATTAGCATGTAAGCTGAAAGTCTTATGCGTTTTATTACGACG GTTGTAAATTATATATTTGAGAATTGTGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 11553781..11554021 | 59..299 | 1190 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 11554222..11554452 | 298..528 | 1155 | 100 | Plus |
chr3L | 24539361 | chr3L | 11553600..11553659 | 1..60 | 285 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 11555960..11556200 | 59..299 | 1205 | 100 | Plus |
3L | 28103327 | 3L | 11556401..11556632 | 298..529 | 1160 | 100 | Plus |
3L | 28103327 | 3L | 11555779..11555838 | 1..60 | 300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11553600..11553658 | 1..59 | 98 | -> | Plus |
chr3L | 11553782..11554021 | 60..299 | 99 | -> | Plus |
chr3L | 11554224..11554452 | 300..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..357 | 57..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..357 | 57..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..357 | 57..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..357 | 57..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..357 | 57..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..528 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..528 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 7..534 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 1..528 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7394-RA | 7..534 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11562679..11562737 | 1..59 | 100 | -> | Plus |
3L | 11562861..11563100 | 60..299 | 100 | -> | Plus |
3L | 11563303..11563531 | 300..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11562679..11562737 | 1..59 | 100 | -> | Plus |
3L | 11562861..11563100 | 60..299 | 100 | -> | Plus |
3L | 11563303..11563531 | 300..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11562679..11562737 | 1..59 | 100 | -> | Plus |
3L | 11562861..11563100 | 60..299 | 100 | -> | Plus |
3L | 11563303..11563531 | 300..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11555779..11555837 | 1..59 | 100 | -> | Plus |
arm_3L | 11555961..11556200 | 60..299 | 100 | -> | Plus |
arm_3L | 11556403..11556631 | 300..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11555961..11556200 | 60..299 | 100 | -> | Plus |
3L | 11556403..11556631 | 300..528 | 100 | Plus | |
3L | 11555779..11555837 | 1..59 | 100 | -> | Plus |
Translation from 56 to 412
> RE52392.pep MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAA SKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGS PYLAAKINEAKDFLDKAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25273-PA | 130 | GF25273-PA | 14..130 | 2..118 | 578 | 94.9 | Plus |
Dana\GF21144-PA | 144 | GF21144-PA | 10..136 | 1..114 | 267 | 40.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15513-PA | 128 | GG15513-PA | 12..128 | 2..118 | 547 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14855-PA | 130 | GH14855-PA | 15..130 | 3..118 | 548 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7394-PC | 118 | CG7394-PC | 1..118 | 1..118 | 595 | 100 | Plus |
CG7394-PD | 118 | CG7394-PD | 1..118 | 1..118 | 595 | 100 | Plus |
CG7394-PA | 118 | CG7394-PA | 1..118 | 1..118 | 595 | 100 | Plus |
CG7394-PB | 128 | CG7394-PB | 12..128 | 2..118 | 590 | 100 | Plus |
CG32727-PA | 122 | CG32727-PA | 53..114 | 47..114 | 142 | 44.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13707-PA | 134 | GI13707-PA | 18..134 | 2..118 | 558 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22802-PA | 126 | GL22802-PA | 10..126 | 2..118 | 562 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20321-PA | 126 | GA20321-PA | 10..126 | 2..118 | 562 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25281-PA | 128 | GM25281-PA | 12..128 | 2..118 | 589 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14312-PA | 128 | GD14312-PA | 12..128 | 2..118 | 592 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14049-PA | 132 | GJ14049-PA | 16..132 | 2..118 | 556 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17173-PA | 139 | GK17173-PA | 23..139 | 2..118 | 546 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21822-PA | 128 | GE21822-PA | 12..128 | 2..118 | 593 | 98.3 | Plus |
Translation from 56 to 412
> RE52392.hyp MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAA SKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGS PYLAAKINEAKDFLDKAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7394-PC | 118 | CG7394-PC | 1..118 | 1..118 | 595 | 100 | Plus |
CG7394-PD | 118 | CG7394-PD | 1..118 | 1..118 | 595 | 100 | Plus |
CG7394-PA | 118 | CG7394-PA | 1..118 | 1..118 | 595 | 100 | Plus |
CG7394-PB | 128 | CG7394-PB | 12..128 | 2..118 | 590 | 100 | Plus |
CG32727-PA | 122 | CG32727-PA | 53..114 | 47..114 | 142 | 44.1 | Plus |