Clone RE52392 Report

Search the DGRC for RE52392

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:523
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG7394-RA
Protein status:RE52392.pep: gold
Preliminary Size:387
Sequenced Size:544

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7394 2001-12-14 Blastp of sequenced clone
CG7394 2002-01-01 Sim4 clustering to Release 2
CG7394 2003-01-01 Sim4 clustering to Release 3
CG7394 2008-04-29 Release 5.5 accounting
CG7394 2008-08-15 Release 5.9 accounting
CG7394 2008-12-18 5.12 accounting

Clone Sequence Records

RE52392.complete Sequence

544 bp (544 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071438

> RE52392.complete
AGCTGACAGCAGGCTATGCAGTTCCACTGACTTACAGCTGTTAAAATTAC
ATAAAAATGGCGAGCTCCGTAATTCTGGCGGGTCTTAGCGTGGCCGCCGT
GGGATTCGCCGGAAAGCACCTGATGCGCCGCATGCCCCAGATGACCACCA
AATTCAACGAGGCCCTCAAGAACCTGCCCAAATACGATGCGGAGAGCATG
GCCGCCTCCAAATACTACAAGGGCGGCTTCGATCCCAAGATGAACAAGCG
GGAGGCGTCCCTAATCCTAGGTGTCAGCCCCAGTGCGTCCAAGATAAAGA
TTAAGGACGCGCACAAGAAGATCATGCTGTTGAACCATCCGGATCGAGGA
GGATCTCCCTATTTGGCGGCCAAGATCAACGAGGCCAAAGACTTTCTGGA
CAAAGCGAAGTAGTCATCCTCTCCCCGCCGTTCAGTGCAAATAAAGTAGT
AGTTCGTGATTAGCATGTAAGCTGAAAGTCTTATGCGTTTTATTACGACG
GTTGTAAATTATATATTTGAGAATTGTGAAAAAAAAAAAAAAAA

RE52392.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG7394-RA 881 CG7394-RA 42..570 1..529 2645 100 Plus
CG7394.a 1390 CG7394.a 42..570 1..529 2645 100 Plus
CG7394.b 1672 CG7394.b 324..852 1..529 2645 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11553781..11554021 59..299 1190 99.6 Plus
chr3L 24539361 chr3L 11554222..11554452 298..528 1155 100 Plus
chr3L 24539361 chr3L 11553600..11553659 1..60 285 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11562860..11563100 59..299 1205 100 Plus
3L 28110227 3L 11563301..11563532 298..529 1160 100 Plus
3L 28110227 3L 11562679..11562738 1..60 300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11555960..11556200 59..299 1205 100 Plus
3L 28103327 3L 11556401..11556632 298..529 1160 100 Plus
3L 28103327 3L 11555779..11555838 1..60 300 100 Plus
Blast to na_te.dros performed 2019-03-16 23:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 502..541 476..437 110 75 Minus
Ivk 5402 Ivk IVK 5402bp 4453..4503 294..347 109 72.2 Plus

RE52392.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:12:05 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11553600..11553658 1..59 98 -> Plus
chr3L 11553782..11554021 60..299 99 -> Plus
chr3L 11554224..11554452 300..528 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:50 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..357 57..413 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:42 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..357 57..413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:19:34 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..357 57..413 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:17 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..357 57..413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:10 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..357 57..413 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:43 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:41 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:19:34 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 7..534 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:17 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:10 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
CG7394-RA 7..534 1..528 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:12:05 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11562679..11562737 1..59 100 -> Plus
3L 11562861..11563100 60..299 100 -> Plus
3L 11563303..11563531 300..528 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:12:05 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11562679..11562737 1..59 100 -> Plus
3L 11562861..11563100 60..299 100 -> Plus
3L 11563303..11563531 300..528 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:12:05 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11562679..11562737 1..59 100 -> Plus
3L 11562861..11563100 60..299 100 -> Plus
3L 11563303..11563531 300..528 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:19:34 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11555779..11555837 1..59 100 -> Plus
arm_3L 11555961..11556200 60..299 100 -> Plus
arm_3L 11556403..11556631 300..528 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:31 Download gff for RE52392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11555961..11556200 60..299 100 -> Plus
3L 11556403..11556631 300..528 100   Plus
3L 11555779..11555837 1..59 100 -> Plus

RE52392.pep Sequence

Translation from 56 to 412

> RE52392.pep
MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAA
SKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGS
PYLAAKINEAKDFLDKAK*

RE52392.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25273-PA 130 GF25273-PA 14..130 2..118 578 94.9 Plus
Dana\GF21144-PA 144 GF21144-PA 10..136 1..114 267 40.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15513-PA 128 GG15513-PA 12..128 2..118 547 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14855-PA 130 GH14855-PA 15..130 3..118 548 88.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG7394-PC 118 CG7394-PC 1..118 1..118 595 100 Plus
CG7394-PD 118 CG7394-PD 1..118 1..118 595 100 Plus
CG7394-PA 118 CG7394-PA 1..118 1..118 595 100 Plus
CG7394-PB 128 CG7394-PB 12..128 2..118 590 100 Plus
CG32727-PA 122 CG32727-PA 53..114 47..114 142 44.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13707-PA 134 GI13707-PA 18..134 2..118 558 89.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22802-PA 126 GL22802-PA 10..126 2..118 562 89.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20321-PA 126 GA20321-PA 10..126 2..118 562 89.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25281-PA 128 GM25281-PA 12..128 2..118 589 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14312-PA 128 GD14312-PA 12..128 2..118 592 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14049-PA 132 GJ14049-PA 16..132 2..118 556 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17173-PA 139 GK17173-PA 23..139 2..118 546 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21822-PA 128 GE21822-PA 12..128 2..118 593 98.3 Plus

RE52392.hyp Sequence

Translation from 56 to 412

> RE52392.hyp
MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAA
SKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGS
PYLAAKINEAKDFLDKAK*

RE52392.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7394-PC 118 CG7394-PC 1..118 1..118 595 100 Plus
CG7394-PD 118 CG7394-PD 1..118 1..118 595 100 Plus
CG7394-PA 118 CG7394-PA 1..118 1..118 595 100 Plus
CG7394-PB 128 CG7394-PB 12..128 2..118 590 100 Plus
CG32727-PA 122 CG32727-PA 53..114 47..114 142 44.1 Plus