Clone RE52411 Report

Search the DGRC for RE52411

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:524
Well:11
Vector:pFlc-1
Associated Gene/Transcriptbai-RA
Protein status:RE52411.pep: gold
Preliminary Size:633
Sequenced Size:822

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11785 2002-01-01 Sim4 clustering to Release 2
CG11785 2002-01-09 Blastp of sequenced clone
CG11785 2003-01-01 Sim4 clustering to Release 3
bai 2008-04-29 Release 5.5 accounting
bai 2008-08-15 Release 5.9 accounting
bai 2008-12-18 5.12 accounting

Clone Sequence Records

RE52411.complete Sequence

822 bp (822 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075503

> RE52411.complete
GTCTTGTGCCAGCTCTATAAAATAGCCACCTCATCTTTGTCAGCCGTAGA
TTTTGTTAGATTTAAATTGTTAGCTATGGCGAGGGCGGCTTTTATTGTGT
GCCTACTGATGGCCTGTGCCTGGAGCAGCCATGCGGTGATGTTCAAGCTG
TCGCCGAACACCCAGAAGTGCCTCAAGGAAGACATCCAGGCGAACCAACT
GGTTATGGGCGAGTTCGAAGTTTCCGACGTACCCGGCCAGATCATCGACT
ACATTGCACGCGACACCAAGGGACACATCCTGTCGCAGAAGGAGCACATC
ACTAAGGGCAAGTTCAGCTTCATGTCCGAGGTGTACGATACGTACGAAAT
CTGCTTTATATCCAAAGTTCCTGCACATCAACGCGGCGTTATACAGGAAG
TATCGCTCTTGACCAAAAAGGGAGTGGAGACCAAGAGCTACGAAGGCATT
GGCGAAGCATCCAAACTGAAGCCCCTTGAAGTTGATCTTAAGCGTTTGGA
GGATCTCTCCGACTCCATTGTGCGTGATTTCGTTCTCATGCGCAAGCGGG
AGGAGGAAATGCGCGATACCAATGAGAAAACCAACAGCCGCGTGCTGTTC
TTCAGCATCTTCAGCATGTGCTGCCTGCTCGGCTTGGCGACGTGGCAAGT
TCTGTACCTCCGCAGGTACTTCAAAGCCAAAAAACTCATCGAATAGTCGT
CTAGCCGTAGTCTTAATGCGTGCGTGGAACTGTGTTTAAATGCCTGGTTT
AGATTTCATCCTTTCATCTTTTGAACGTTTTTCTGAAATAAATGCAACTA
CCACGTAAAAAAAAAAAAAAAA

RE52411.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
bai-RA 1040 bai-RA 95..901 1..807 4035 100 Plus
5PtaseI-RB 1745 5PtaseI-RB 1700..1745 807..762 230 100 Minus
5PtaseI-RF 2685 5PtaseI-RF 2640..2685 807..762 230 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20862561..20862816 1..256 1280 100 Plus
chr3R 27901430 chr3R 20863397..20863629 574..806 1165 100 Plus
chr3R 27901430 chr3R 20863208..20863334 448..574 635 100 Plus
chr3R 27901430 chr3R 20862887..20863007 256..376 560 97.5 Plus
chr3R 27901430 chr3R 20863067..20863142 372..447 365 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25039375..25039630 1..256 1280 100 Plus
3R 32079331 3R 25040211..25040444 574..807 1170 100 Plus
3R 32079331 3R 25040022..25040148 448..574 635 100 Plus
3R 32079331 3R 25039701..25039821 256..376 605 100 Plus
3R 32079331 3R 25039881..25039956 372..447 365 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24780206..24780461 1..256 1280 100 Plus
3R 31820162 3R 24781042..24781275 574..807 1170 100 Plus
3R 31820162 3R 24780853..24780979 448..574 635 100 Plus
3R 31820162 3R 24780532..24780652 256..376 605 100 Plus
3R 31820162 3R 24780712..24780787 372..447 365 98.6 Plus
Blast to na_te.dros performed on 2019-03-16 14:21:22 has no hits.

RE52411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:22:11 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20862561..20862815 1..255 100 -> Plus
chr3R 20862887..20863007 256..376 97 -> Plus
chr3R 20863072..20863142 377..447 100 -> Plus
chr3R 20863208..20863334 448..574 100 -> Plus
chr3R 20863398..20863629 575..806 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:30 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..621 76..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:07:01 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..621 76..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:37 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..621 76..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:38 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..621 76..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:18 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..806 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:30 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..806 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:07:01 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 2..807 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:37 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 1..806 1..806 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:38 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
bai-RA 2..807 1..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:11 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25039375..25039629 1..255 100 -> Plus
3R 25039701..25039821 256..376 100 -> Plus
3R 25039886..25039956 377..447 100 -> Plus
3R 25040022..25040148 448..574 100 -> Plus
3R 25040212..25040443 575..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:11 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25039375..25039629 1..255 100 -> Plus
3R 25039701..25039821 256..376 100 -> Plus
3R 25039886..25039956 377..447 100 -> Plus
3R 25040022..25040148 448..574 100 -> Plus
3R 25040212..25040443 575..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:11 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25039375..25039629 1..255 100 -> Plus
3R 25039701..25039821 256..376 100 -> Plus
3R 25039886..25039956 377..447 100 -> Plus
3R 25040022..25040148 448..574 100 -> Plus
3R 25040212..25040443 575..806 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:07:01 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20865097..20865351 1..255 100 -> Plus
arm_3R 20865423..20865543 256..376 100 -> Plus
arm_3R 20865608..20865678 377..447 100 -> Plus
arm_3R 20865744..20865870 448..574 100 -> Plus
arm_3R 20865934..20866165 575..806 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:33 Download gff for RE52411.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24780206..24780460 1..255 100 -> Plus
3R 24780532..24780652 256..376 100 -> Plus
3R 24780717..24780787 377..447 100 -> Plus
3R 24780853..24780979 448..574 100 -> Plus
3R 24781043..24781274 575..806 100   Plus

RE52411.hyp Sequence

Translation from 0 to 695

> RE52411.hyp
VLCQLYKIATSSLSAVDFVRFKLLAMARAAFIVCLLMACAWSSHAVMFKL
SPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTKGHILSQKEHI
TKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGI
GEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLF
FSIFSMCCLLGLATWQVLYLRRYFKAKKLIE*

RE52411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
bai-PA 206 CG11785-PA 1..206 26..231 1054 100 Plus
eca-PA 216 CG33104-PA 2..216 28..230 218 27.9 Plus
CHOp24-PB 208 CG3564-PB 5..208 26..230 186 23.6 Plus
CHOp24-PA 208 CG3564-PA 5..208 26..230 186 23.6 Plus
p24-2-PB 244 CG33105-PB 2..206 28..220 179 26.3 Plus

RE52411.pep Sequence

Translation from 75 to 695

> RE52411.pep
MARAAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVS
DVPGQIIDYIARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPA
HQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSDSIVR
DFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYFK
AKKLIE*

RE52411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16422-PA 206 GF16422-PA 1..206 1..206 1007 90.8 Plus
Dana\GF23165-PA 216 GF23165-PA 17..216 17..205 208 27 Plus
Dana\GF19355-PA 208 GF19355-PA 19..208 15..205 160 25.1 Plus
Dana\GF19411-PA 226 GF19411-PA 40..217 23..203 147 25.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11349-PA 206 GG11349-PA 1..206 1..206 1083 97.6 Plus
Dere\GG17343-PA 216 GG17343-PA 2..216 3..205 223 28.4 Plus
Dere\GG18710-PA 208 GG18710-PA 21..208 17..205 179 26.4 Plus
Dere\GG18829-PA 210 GG18829-PA 8..201 6..203 155 25 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22337-PA 185 GH22337-PA 1..185 22..206 928 93 Plus
Dgri\GH18190-PA 216 GH18190-PA 5..216 7..205 225 28.3 Plus
Dgri\GH24063-PA 209 GH24063-PA 23..209 18..205 159 25.7 Plus
Dgri\GH11947-PA 238 GH11947-PA 52..229 23..203 142 25.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
bai-PA 206 CG11785-PA 1..206 1..206 1054 100 Plus
eca-PA 216 CG33104-PA 2..216 3..205 218 27.9 Plus
CHOp24-PB 208 CG3564-PB 5..208 1..205 186 23.6 Plus
CHOp24-PA 208 CG3564-PA 5..208 1..205 186 23.6 Plus
p24-2-PB 244 CG33105-PB 2..206 3..195 179 26.3 Plus
p24-2-PA 244 CG33105-PA 2..206 3..195 179 26.3 Plus
p24-1-PB 210 CG1967-PB 8..201 6..203 147 25.5 Plus
p24-1-PA 210 CG1967-PA 8..201 6..203 147 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23975-PA 206 GI23975-PA 1..206 1..206 986 87.9 Plus
Dmoj\GI15674-PA 206 GI15674-PA 1..206 1..206 774 68 Plus
Dmoj\GI10144-PA 216 GI10144-PA 2..216 3..205 219 27.4 Plus
Dmoj\GI15191-PA 208 GI15191-PA 21..208 17..205 150 23.8 Plus
Dmoj\GI15363-PA 235 GI15363-PA 35..226 11..203 150 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21889-PA 206 GL21889-PA 1..206 1..206 983 88.3 Plus
Dper\GL12279-PA 216 GL12279-PA 17..216 17..205 211 27.5 Plus
Dper\GL19967-PA 208 GL19967-PA 19..208 15..205 167 25.1 Plus
Dper\GL12278-PA 291 GL12278-PA 1..207 1..196 158 23.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17284-PA 216 GA17284-PA 17..216 17..205 210 27.5 Plus
Dpse\GA28584-PA 208 GA28584-PA 19..208 15..205 163 24.6 Plus
Dpse\GA26252-PB 291 GA26252-PB 1..207 1..196 160 24.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17789-PA 140 GM17789-PA 1..102 1..102 534 95.1 Plus
Dsec\GM26230-PA 216 GM26230-PA 9..216 5..205 220 28.2 Plus
Dsec\GM17789-PA 140 GM17789-PA 101..140 167..206 210 97.5 Plus
Dsec\GM12348-PA 208 GM12348-PA 21..208 17..205 182 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21160-PA 206 GD21160-PA 1..206 1..206 1091 98.5 Plus
Dsim\GD20772-PA 216 GD20772-PA 9..216 5..205 221 28.2 Plus
Dsim\GD16693-PA 208 GD16693-PA 21..208 17..205 182 26.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14134-PA 206 GJ14134-PA 1..206 1..206 970 86.9 Plus
Dvir\GJ23362-PA 216 GJ23362-PA 2..216 3..205 220 27.4 Plus
Dvir\GJ14798-PA 208 GJ14798-PA 21..208 17..205 153 26.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14360-PA 206 GK14360-PA 1..206 1..206 953 84 Plus
Dwil\GK25550-PA 201 GK25550-PA 1..156 1..153 406 48.1 Plus
Dwil\GK12749-PA 216 GK12749-PA 2..216 3..205 232 28.4 Plus
Dwil\GK14515-PA 299 GK14515-PA 115..299 20..205 143 24.2 Plus
Dwil\GK10123-PA 224 GK10123-PA 20..215 4..203 140 23.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23545-PA 206 GE23545-PA 1..206 1..206 1083 97.6 Plus
Dyak\GE24749-PA 216 GE24749-PA 2..216 3..205 224 28.4 Plus
Dyak\GE16348-PA 208 GE16348-PA 5..208 1..205 180 25.3 Plus
Dyak\GE17592-PA 210 GE17592-PA 8..201 6..203 156 25 Plus