Clone RE52427 Report

Search the DGRC for RE52427

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:524
Well:27
Vector:pFlc-1
Associated Gene/TranscriptTaf13-RA
Protein status:RE52427.pep: gold
Sequenced Size:641

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10756 2001-12-14 Blastp of sequenced clone
CG10756 2002-01-01 Sim4 clustering to Release 2
CG10756 2003-01-01 Sim4 clustering to Release 3
Taf13 2008-04-29 Release 5.5 accounting
Taf13 2008-08-15 Release 5.9 accounting
Taf13 2008-12-18 5.12 accounting

Clone Sequence Records

RE52427.complete Sequence

641 bp (641 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071439

> RE52427.complete
GCTCATTCAATGCGGTGTTACTCGCGTAAACACAAAATTTGTATACAAAT
TCAACGTTTTAATTGAAGTCTGAGCACTATGGCCTCAAATAGCATGCCAG
AGGAGAATTTCGAGGGCGGTGATTTCAACTTTGATGACGACGCGGAGGAT
GACCAATTTGTGGCTACCAACTCAGGACGAAAGCGCCTATTCAGCAAGGA
GCTGCGCTGCATGATGTTCGGATTCGGAGACGACAAAAATCCATACACGG
AAACCGTAGATCTGTTGGAAGACCTGGTCATTGAGTATATAGCTGAGACC
ACTCACCGGGCAATGGAGATCGGTCGAACAGGCCGTGTTCAAGTCGAAGA
CATTATCTTCCTGGTGCGCAAAGATCCCCGAAAGTACGCTAGGGTGAAGG
ATCTTCTGACCATGAACGAGGAGTTGAAAAAGGCACGAAAGGCCTTCGAT
GAGATCAAGTATGTGGGCACCGAAGGCAAGCTCAAATGACAGCGGTCAAA
AAAAGCCACACCAAATCCAGGTATAAGCCAAACCTAGCAGTTAGCTCCAA
GATGCGAATTATTTTTAATGTCTTTAATACTCTAAGCTAGCGCATAATAA
ACTAATCAAAATAGTCTTCAATGCCAAAAAAAAAAAAAAAA

RE52427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-RA 741 Taf13-RA 43..669 1..627 3105 99.6 Plus
CG10721.a 1566 CG10721.a 1506..1566 627..567 290 98.3 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20091726..20092069 467..124 1675 99.1 Minus
chr2L 23010047 chr2L 20091499..20091656 623..466 775 99.4 Minus
chr2L 23010047 chr2L 20092133..20092255 123..1 615 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20093317..20093660 467..124 1705 99.7 Minus
2L 23513712 2L 20093086..20093247 627..466 795 99.4 Minus
2L 23513712 2L 20093724..20093846 123..1 615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20093317..20093660 467..124 1705 99.7 Minus
2L 23513712 2L 20093086..20093247 627..466 795 99.3 Minus
2L 23513712 2L 20093724..20093846 123..1 615 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:17:41 has no hits.

RE52427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:18:19 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20091497..20091655 467..625 98 <- Minus
chr2L 20091727..20092069 124..466 99 <- Minus
chr2L 20092133..20092255 1..123 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:54 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..411 79..489 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:39 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..411 79..489 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:06 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..411 79..489 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:55 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..411 79..489 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:29 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..411 79..489 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:17 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..625 1..625 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:38 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..625 1..625 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:06 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 4..628 1..625 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:55 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..625 1..625 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:29 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 4..628 1..625 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:19 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20093088..20093246 467..625 99 <- Minus
2L 20093318..20093660 124..466 99 <- Minus
2L 20093724..20093846 1..123 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:19 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20093088..20093246 467..625 99 <- Minus
2L 20093318..20093660 124..466 99 <- Minus
2L 20093724..20093846 1..123 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:19 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20093088..20093246 467..625 99 <- Minus
2L 20093318..20093660 124..466 99 <- Minus
2L 20093724..20093846 1..123 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:06 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20093088..20093246 467..625 99 <- Minus
arm_2L 20093318..20093660 124..466 99 <- Minus
arm_2L 20093724..20093846 1..123 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:37 Download gff for RE52427.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20093318..20093660 124..466 99 <- Minus
2L 20093724..20093846 1..123 100   Minus
2L 20093088..20093246 467..625 99 <- Minus

RE52427.pep Sequence

Translation from 78 to 488

> RE52427.pep
MASNSMPEENFEGGDFNFDDDAEDDQFVATNSGRKRLFSKELRCMMFGFG
DDKNPYTETVDLLEDLVIEYIAETTHRAMEIGRTGRVQVEDIIFLVRKDP
RKYARVKDLLTMNEELKKARKAFDEIKYVGTEGKLK*

RE52427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14449-PA 136 GF14449-PA 1..136 1..136 606 94.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21587-PA 136 GG21587-PA 1..136 1..136 703 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13659-PA 134 GH13659-PA 1..134 1..136 576 87.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-PA 136 CG10756-PA 1..136 1..136 703 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17411-PA 134 GI17411-PA 1..134 1..136 578 88.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26351-PA 136 GL26351-PA 1..136 1..136 622 95.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10547-PA 136 GA10547-PA 1..136 1..136 622 95.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16962-PA 135 GM16962-PA 1..130 1..130 681 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11962-PA 136 GD11962-PA 1..136 1..136 710 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18344-PA 134 GJ18344-PA 1..134 1..136 586 89 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18673-PA 135 GK18673-PA 1..135 1..136 608 89.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12606-PA 136 GE12606-PA 1..136 1..136 705 99.3 Plus

RE52427.hyp Sequence

Translation from 78 to 488

> RE52427.hyp
MASNSMPEENFEGGDFNFDDDAEDDQFVATNSGRKRLFSKELRCMMFGFG
DDKNPYTETVDLLEDLVIEYIAETTHRAMEIGRTGRVQVEDIIFLVRKDP
RKYARVKDLLTMNEELKKARKAFDEIKYVGTEGKLK*

RE52427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-PA 136 CG10756-PA 1..136 1..136 703 100 Plus