BDGP Sequence Production Resources |
Search the DGRC for RE52596
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 525 |
Well: | 96 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG31917-RA |
Protein status: | RE52596.pep: gold RE52596.pep2: gold |
Preliminary Size: | 210 |
Sequenced Size: | 853 |
Gene | Date | Evidence |
---|---|---|
CG31917 | 2001-12-14 | Blastp of sequenced clone |
CG14037 | 2002-01-01 | Sim4 clustering to Release 2 |
CG31917 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31917 | 2008-04-29 | Release 5.5 accounting |
CG31917 | 2008-08-15 | Release 5.9 accounting |
CG42373 | 2008-12-18 | 5.12 accounting |
CG31917 | 2008-12-18 | 5.12 accounting |
853 bp (853 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071441.1
> RE52596.complete ATTCAGCTCTGAGAATTGGTGAGATTGTTTATTAATTTCGGCAAACAAAT GCTGGCAACATGGTAAATGTTATGAAAGGAGTGCTGGTGGAGTGTGATCC TGCTATGAAACAATTCCTGCTGCACTTGGACGAAAAACTGGCTCTGGGAC GCAAATTCATTATCCAGGATCTGGACGAGAACCATTTGTTTATCTCCACG GACATTGTGGAAGTTTTGCAGGCGCGAGTGGACGACTTGATGGATCGGAT AAGCTTTCCGCTGCACGACAAGGACGCTTAGAACCTACACAACCCATAAA ATCCAATAGCCAAAAGTAAAAACCTAAAAACAACCATGACGGGTCGCGAA TCCAACCGCATCAAGGACGCTGAAAAGAAGCGTGTCCTGGACTCCACAGC CCGCCAGCGGCGTGCCCGCAAAGCCTTGGAGGCTCTGGAGCAGGACAACT ACCACGATGACCCACACGCCGACCTTGTCATGTCCAAGAAGTTGCCCAAA TTCCAGGACAGCCTGAAGACCGGCAAGGAGAAGAAAGGCAAGCGCAAGGG CGCCGAATACTTTCTCGTCAAGTATCGCAAGAACTTCCAGCAACTGCTCG AGGAGGACAAGGACAAGCAGCCCAACTACGAGAGCGCCGCAGCGCCGGCT CCACAAAAGCCACTGCGGCATTTCTGCGCCGTTTGCGGCAACTTCTCGTT GTACTCGTGCACCGCCTGCGGAACGCGATACTGTTGCGTTAGATGCCTGC AAACGCACCAGGACACGCGCTGCCTCAAGTGGACGGCCTGAGCATGGTTG TTATGTTTACAAATAAATCAAACATTAGGCATAACTGAAAAAAAAAAAAA AAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 5009031..5009773 | 95..837 | 100 | <- | Minus |
chr2L | 5009832..5009925 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 1..456 | 336..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 1..456 | 336..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 1..456 | 336..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 1..456 | 336..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 1..456 | 336..791 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42373-RA | 1..834 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tfb5-RB | 1..837 | 1..837 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 10..846 | 1..837 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31917-RA | 1..834 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tfb5-RB | 10..846 | 1..837 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5009931..5010673 | 95..837 | 100 | <- | Minus |
2L | 5010732..5010825 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5009931..5010673 | 95..837 | 100 | <- | Minus |
2L | 5010732..5010825 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5009931..5010673 | 95..837 | 100 | <- | Minus |
2L | 5010732..5010825 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 5009931..5010673 | 95..837 | 100 | <- | Minus |
arm_2L | 5010732..5010825 | 1..94 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5009931..5010673 | 95..837 | 100 | <- | Minus |
2L | 5010732..5010825 | 1..94 | 100 | Minus |
Translation from 59 to 280
> RE52596.pep2 MVNVMKGVLVECDPAMKQFLLHLDEKLALGRKFIIQDLDENHLFISTDIV EVLQARVDDLMDRISFPLHDKDA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15714-PA | 73 | GF15714-PA | 1..73 | 1..73 | 357 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24326-PA | 73 | GG24326-PA | 1..73 | 1..73 | 368 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tfb5-PB | 73 | CG42373-PB | 1..73 | 1..73 | 371 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14600-PA | 73 | GI14600-PA | 1..73 | 1..73 | 356 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26481-PA | 73 | GL26481-PA | 1..73 | 1..73 | 364 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28879-PA | 73 | GA28879-PA | 1..73 | 1..73 | 364 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18045-PA | 73 | GM18045-PA | 1..73 | 1..73 | 368 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11985-PA | 73 | GD11985-PA | 1..73 | 1..73 | 368 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17109-PA | 73 | GJ17109-PA | 1..73 | 1..73 | 358 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18705-PA | 73 | GE18705-PA | 1..73 | 1..73 | 368 | 100 | Plus |
Translation from 335 to 790
> RE52596.hyp MTGRESNRIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMS KKLPKFQDSLKTGKEKKGKRKGAEYFLVKYRKNFQQLLEEDKDKQPNYES AAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYCCVRCLQTHQDTRCLKWT A*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31917-PA | 151 | CG31917-PA | 1..151 | 1..151 | 815 | 100 | Plus |
Translation from 335 to 790
> RE52596.pep MTGRESNRIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMS KKLPKFQDSLKTGKEKKGKRKGAEYFLVKYRKNFQQLLEEDKDKQPNYES AAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYCCVRCLQTHQDTRCLKWT A*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15715-PA | 150 | GF15715-PA | 1..150 | 1..151 | 664 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24327-PA | 151 | GG24327-PA | 1..151 | 1..151 | 768 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11422-PA | 150 | GH11422-PA | 1..150 | 1..151 | 583 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31917-PA | 151 | CG31917-PA | 1..151 | 1..151 | 815 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14611-PA | 150 | GI14611-PA | 1..150 | 1..151 | 636 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26482-PA | 150 | GL26482-PA | 1..150 | 1..151 | 711 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16563-PA | 150 | GA16563-PA | 1..150 | 1..151 | 711 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18046-PA | 151 | GM18046-PA | 1..151 | 1..151 | 800 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22667-PA | 103 | GD22667-PA | 1..103 | 49..151 | 545 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17119-PA | 150 | GJ17119-PA | 1..150 | 1..151 | 587 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21077-PA | 150 | GK21077-PA | 1..150 | 1..151 | 665 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18706-PA | 151 | GE18706-PA | 1..151 | 1..151 | 775 | 96.7 | Plus |