Clone RE52596 Report

Search the DGRC for RE52596

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:525
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG31917-RA
Protein status:RE52596.pep: gold RE52596.pep2: gold
Preliminary Size:210
Sequenced Size:853

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31917 2001-12-14 Blastp of sequenced clone
CG14037 2002-01-01 Sim4 clustering to Release 2
CG31917 2003-01-01 Sim4 clustering to Release 3
CG31917 2008-04-29 Release 5.5 accounting
CG31917 2008-08-15 Release 5.9 accounting
CG42373 2008-12-18 5.12 accounting
CG31917 2008-12-18 5.12 accounting

Clone Sequence Records

RE52596.complete Sequence

853 bp (853 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071441.1

> RE52596.complete
ATTCAGCTCTGAGAATTGGTGAGATTGTTTATTAATTTCGGCAAACAAAT
GCTGGCAACATGGTAAATGTTATGAAAGGAGTGCTGGTGGAGTGTGATCC
TGCTATGAAACAATTCCTGCTGCACTTGGACGAAAAACTGGCTCTGGGAC
GCAAATTCATTATCCAGGATCTGGACGAGAACCATTTGTTTATCTCCACG
GACATTGTGGAAGTTTTGCAGGCGCGAGTGGACGACTTGATGGATCGGAT
AAGCTTTCCGCTGCACGACAAGGACGCTTAGAACCTACACAACCCATAAA
ATCCAATAGCCAAAAGTAAAAACCTAAAAACAACCATGACGGGTCGCGAA
TCCAACCGCATCAAGGACGCTGAAAAGAAGCGTGTCCTGGACTCCACAGC
CCGCCAGCGGCGTGCCCGCAAAGCCTTGGAGGCTCTGGAGCAGGACAACT
ACCACGATGACCCACACGCCGACCTTGTCATGTCCAAGAAGTTGCCCAAA
TTCCAGGACAGCCTGAAGACCGGCAAGGAGAAGAAAGGCAAGCGCAAGGG
CGCCGAATACTTTCTCGTCAAGTATCGCAAGAACTTCCAGCAACTGCTCG
AGGAGGACAAGGACAAGCAGCCCAACTACGAGAGCGCCGCAGCGCCGGCT
CCACAAAAGCCACTGCGGCATTTCTGCGCCGTTTGCGGCAACTTCTCGTT
GTACTCGTGCACCGCCTGCGGAACGCGATACTGTTGCGTTAGATGCCTGC
AAACGCACCAGGACACGCGCTGCCTCAAGTGGACGGCCTGAGCATGGTTG
TTATGTTTACAAATAAATCAAACATTAGGCATAACTGAAAAAAAAAAAAA
AAA

RE52596.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Tfb5-RB 837 Tfb5-RB 1..837 1..837 4185 100 Plus
CG31917-RA 837 CG31917-RA 1..837 1..837 4185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5009031..5009774 837..94 3720 100 Minus
chr2L 23010047 chr2L 5009832..5009925 94..1 470 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5009929..5010674 839..94 3730 100 Minus
2L 23513712 2L 5010732..5010825 94..1 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5009929..5010674 839..94 3730 100 Minus
2L 23513712 2L 5010732..5010825 94..1 470 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:21:04 has no hits.

RE52596.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:50 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5009031..5009773 95..837 100 <- Minus
chr2L 5009832..5009925 1..94 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:05 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 1..456 336..791 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:16 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 1..456 336..791 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:11:49 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 1..456 336..791 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:24 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 1..456 336..791 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:31 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 1..456 336..791 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:27 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG42373-RA 1..834 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:16 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb5-RB 1..837 1..837 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:49 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 10..846 1..837 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:24 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
CG31917-RA 1..834 1..834 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:31 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb5-RB 10..846 1..837 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:50 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5009931..5010673 95..837 100 <- Minus
2L 5010732..5010825 1..94 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:50 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5009931..5010673 95..837 100 <- Minus
2L 5010732..5010825 1..94 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:50 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5009931..5010673 95..837 100 <- Minus
2L 5010732..5010825 1..94 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:49 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5009931..5010673 95..837 100 <- Minus
arm_2L 5010732..5010825 1..94 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:03 Download gff for RE52596.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5009931..5010673 95..837 100 <- Minus
2L 5010732..5010825 1..94 100   Minus

RE52596.pep2 Sequence

Translation from 59 to 280

> RE52596.pep2
MVNVMKGVLVECDPAMKQFLLHLDEKLALGRKFIIQDLDENHLFISTDIV
EVLQARVDDLMDRISFPLHDKDA*

RE52596.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15714-PA 73 GF15714-PA 1..73 1..73 357 97.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24326-PA 73 GG24326-PA 1..73 1..73 368 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Tfb5-PB 73 CG42373-PB 1..73 1..73 371 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14600-PA 73 GI14600-PA 1..73 1..73 356 95.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26481-PA 73 GL26481-PA 1..73 1..73 364 98.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28879-PA 73 GA28879-PA 1..73 1..73 364 98.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18045-PA 73 GM18045-PA 1..73 1..73 368 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11985-PA 73 GD11985-PA 1..73 1..73 368 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17109-PA 73 GJ17109-PA 1..73 1..73 358 95.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18705-PA 73 GE18705-PA 1..73 1..73 368 100 Plus

RE52596.hyp Sequence

Translation from 335 to 790

> RE52596.hyp
MTGRESNRIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMS
KKLPKFQDSLKTGKEKKGKRKGAEYFLVKYRKNFQQLLEEDKDKQPNYES
AAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYCCVRCLQTHQDTRCLKWT
A*

RE52596.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31917-PA 151 CG31917-PA 1..151 1..151 815 100 Plus

RE52596.pep Sequence

Translation from 335 to 790

> RE52596.pep
MTGRESNRIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMS
KKLPKFQDSLKTGKEKKGKRKGAEYFLVKYRKNFQQLLEEDKDKQPNYES
AAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYCCVRCLQTHQDTRCLKWT
A*

RE52596.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15715-PA 150 GF15715-PA 1..150 1..151 664 88.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24327-PA 151 GG24327-PA 1..151 1..151 768 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11422-PA 150 GH11422-PA 1..150 1..151 583 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31917-PA 151 CG31917-PA 1..151 1..151 815 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14611-PA 150 GI14611-PA 1..150 1..151 636 86.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26482-PA 150 GL26482-PA 1..150 1..151 711 88.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16563-PA 150 GA16563-PA 1..150 1..151 711 88.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18046-PA 151 GM18046-PA 1..151 1..151 800 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22667-PA 103 GD22667-PA 1..103 49..151 545 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17119-PA 150 GJ17119-PA 1..150 1..151 587 88.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21077-PA 150 GK21077-PA 1..150 1..151 665 90.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18706-PA 151 GE18706-PA 1..151 1..151 775 96.7 Plus