Clone RE52740 Report

Search the DGRC for RE52740

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:527
Well:40
Vector:pFlc-1
Associated Gene/TranscriptOrc6-RA
Protein status:RE52740.pep: gold
Preliminary Size:899
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1584 2001-12-14 Blastp of sequenced clone
CG1584 2002-01-01 Sim4 clustering to Release 2
CG1584 2003-01-01 Sim4 clustering to Release 3
Orc6 2008-04-29 Release 5.5 accounting
Orc6 2008-08-15 Release 5.9 accounting
Orc6 2008-12-18 5.12 accounting

Clone Sequence Records

RE52740.complete Sequence

963 bp (963 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071443

> RE52740.complete
TGGTTGTACTTTATTTTGGTTTTAACGACGCACGACTGGAATTTCAGTCT
ATTGTTAATAACTACAATGACTACCTTAATAGAACAGTTAATTACGAAAA
TGGGCCTAAGGGAGGAGCCAAACGTGCTAGAGAAAACCACCGAACTAGTA
CGCCTCCTGGAACTGCGCTCCACGAATGTCCCTCTGCAGATCAACGAGTA
CGGAAAGATAGTGCTGTGTGCGGATCTCGCTTCCTGCATGATTGGGATCG
CTTTCGACAAGGAGCAGGCACTGAAATTGTCAGGATTGCGAAAGAGCCAA
TACCTCAACAACAAGCGGATGTTCGAGAAGCTACTGGACCTAAACAAACT
GGCTAGCGTGAATGACATCTGTGTCCAGCTGGGTCTCAACGAAGTTGCCC
GCAAGGCGGAAGAGCTAATGACTCTCTTCAAGGGCGTAGCGGCCACCGAG
GACATGGGTACCGACACCAGCCATCCTCAGTACGCCACCATGGCCGTGTT
CCAGGCCTGCCGCCTGCTCAAAAAGAAGGTTTCGAAATCAAAGCTCATGC
CCTTCAGTAATTTGCGACCCTCCCAGTTTCAACTGCTCGAGCAGCAGTGG
GAACGCATGATAGCTAAGCACCACAAGGAGAGCAAAGTACCATCTAGCAC
CGATATGGAGGGTAAACTTAAGGAGAACCAGAATGAGAATATCAAGGGTC
ATGAGGCAAAAAAGGCACATAAGCCCCCACCGGAGGACTACGAAATATGG
AAGGCGCGAATGTTGGCCAAGGCGCAGGCCAAATTGAAGGAATTAGAAGC
ATCCCAATCGCATATGGATAGCCAGCTTCTCGAGGCTTAGGCATTTATAT
TTTACATCTTTAAACATTTCCTAGTGAAATCCAGTTTGAATTAATTACTT
ATTATATAACTTATTTATTAAACTGAACATTCTTATTAGTTTTAAGCAAA
AAAAAAAAAAAAA

RE52740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Orc6-RA 1066 Orc6-RA 100..1052 3..955 4735 99.7 Plus
CG1667-RA 1609 CG1667-RA 1545..1609 955..891 295 96.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5732938..5733752 946..132 4075 100 Minus
chr2R 21145070 chr2R 5733808..5733937 132..3 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9845450..9846273 955..132 4090 99.8 Minus
2R 25286936 2R 9846329..9846458 132..3 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9846649..9847472 955..132 4090 99.7 Minus
2R 25260384 2R 9847528..9847657 132..3 650 100 Minus
Blast to na_te.dros performed 2019-03-15 16:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 1916..2009 848..942 112 63.3 Plus

RE52740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:31:56 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5732937..5733752 132..947 99 <- Minus
chr2R 5733809..5733938 1..131 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:09 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 1..774 67..840 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:31 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 1..774 67..840 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:04:00 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 1..774 67..840 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:41 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 1..774 67..840 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:02 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 1..774 67..840 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:24 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 2..945 3..947 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:31 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 2..945 3..946 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:00 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 26..971 1..947 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:41 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 2..945 3..947 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:02 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
Orc6-RA 26..971 1..947 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:31:56 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9845458..9846273 132..947 99 <- Minus
2R 9846330..9846459 1..131 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:31:56 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9845458..9846273 132..947 99 <- Minus
2R 9846330..9846459 1..131 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:31:56 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9845458..9846273 132..947 99 <- Minus
2R 9846330..9846459 1..131 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:00 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5732963..5733778 132..947 99 <- Minus
arm_2R 5733835..5733964 1..131 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:11:56 Download gff for RE52740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9846657..9847472 132..947 99 <- Minus
2R 9847529..9847658 1..131 99   Minus

RE52740.hyp Sequence

Translation from 3 to 839

> RE52740.hyp
LYFILVLTTHDWNFSLLLITTMTTLIEQLITKMGLREEPNVLEKTTELVR
LLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQALKLSGLRKSQY
LNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFKGVAATED
MGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWE
RMIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWK
ARMLAKAQAKLKELEASQSHMDSQLLEA*

RE52740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Orc6-PA 257 CG1584-PA 1..257 22..278 1300 100 Plus

RE52740.pep Sequence

Translation from 66 to 839

> RE52740.pep
MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVL
CADLASCMIGIAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVND
ICVQLGLNEVARKAEELMTLFKGVAATEDMGTDTSHPQYATMAVFQACRL
LKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDMEGK
LKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLKELEASQSHM
DSQLLEA*

RE52740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13143-PA 253 GF13143-PA 1..248 1..248 1030 78.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25256-PA 257 GG25256-PA 1..257 1..257 1206 88.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21326-PA 246 GH21326-PA 1..245 1..251 798 67.6 Plus
Dgri\GH23282-PA 226 GH23282-PA 3..225 23..251 703 65.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Orc6-PA 257 CG1584-PA 1..257 1..257 1300 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20744-PA 243 GI20744-PA 1..240 1..244 767 67.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10239-PA 252 GL10239-PA 1..248 1..249 963 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24134-PA 252 GA24134-PA 1..248 1..249 963 78.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24395-PA 246 GM24395-PA 1..245 12..256 1176 95.1 Plus
Dsec\GM20574-PA 77 GM20574-PA 1..76 181..256 344 88.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10047-PA 246 GD10047-PA 1..245 12..256 1248 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20481-PA 247 GJ20481-PA 1..238 1..245 773 72.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20964-PA 254 GK20964-PA 1..248 1..246 946 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22006-PA 246 GE22006-PA 1..246 12..257 1156 91.9 Plus
Dyak\GE14906-PA 159 GE14906-PA 5..159 103..257 627 81.9 Plus