Clone RE52852 Report

Search the DGRC for RE52852

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:528
Well:52
Vector:pFlc-1
Associated Gene/TranscriptRpL28-RA
Protein status:RE52852.pep: gold
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12740 2001-12-14 Blastp of sequenced clone
CG12740 2002-01-01 Sim4 clustering to Release 2
CG12740 2003-01-01 Sim4 clustering to Release 3
RpL28 2008-04-29 Release 5.5 accounting
RpL28 2008-08-15 Release 5.9 accounting
RpL28 2008-12-18 5.12 accounting

Clone Sequence Records

RE52852.complete Sequence

561 bp (561 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071444

> RE52852.complete
CTTTTTTCCTTCTTGTATTTCAACGAGAAAAGACGTGAGATGGCAACCTC
TTCGCACCTCAATTGGTTGATCATTCGCAACAACAACGCCTTCTTGTTGA
AGAAGCGCGATGTGAAGAAGCCCTTCAGCACAGAGCCAAACAACTTGGCC
AGCGTGAGCTCGTACCGCTACAGCGGCATCGTGCACAAGAAGACCCTGGG
AGTCGTGCCAGCTGCCGACAAGAAGGGCTTCACCGCCGTGCTGAAGAAGG
GCAAGTATGCCCAGCGCCCCGCCAAGAACACCGTGCGTGTTGACTTCAAG
GCCGGTCCCCGCCGTTCCCTGAAGAAGCTGAAGAACCTGCTTATCGGCTC
CAAGTACCGCAAGGACCTGACACAGGCTGCCCTCCGCCGCGCTTCCGCTG
TCCTGCGCTCCCAGAAGCCCGCCCCCGTCAAGGGAAAGAAGGCCGAGTTT
GCTAAGGGAAAGAAGCCCGAATAAACTGTACCAGATTGGGGCTATGCGGA
GCTGTTTTCTACTCGAGAATAAAGAAAAAATATTAAAAACACCCTAAAAA
AAAAAAAAAAA

RE52852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpL28-RF 827 RpL28-RF 110..626 31..547 2570 99.8 Plus
RpL28-RB 973 RpL28-RB 170..686 31..547 2570 99.8 Plus
RpL28-RC 1156 RpL28-RC 170..515 31..376 1730 100 Plus
RpL28-RC 1156 RpL28-RC 696..869 374..547 855 99.4 Plus
RpL28-RC 1156 RpL28-RC 5..32 5..32 140 100 Plus
RpL28-RF 827 RpL28-RF 5..32 5..32 140 100 Plus
RpL28-RB 973 RpL28-RB 5..32 5..32 140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3220870..3221113 376..133 1220 100 Minus
chr3L 24539361 chr3L 3220520..3220689 543..374 820 98.8 Minus
chr3L 24539361 chr3L 3221285..3221387 133..31 515 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3221466..3221709 376..133 1220 100 Minus
3L 28110227 3L 3221112..3221285 547..374 855 99.4 Minus
3L 28110227 3L 3221881..3221983 133..31 515 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3221466..3221709 376..133 1220 100 Minus
3L 28103327 3L 3221112..3221285 547..374 855 99.4 Minus
3L 28103327 3L 3221881..3221983 133..31 515 100 Minus
3L 28103327 3L 3222927..3222954 32..5 140 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:55:42 has no hits.

RE52852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:56:27 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3220518..3220687 376..545 98 <- Minus
chr3L 3220871..3221113 133..375 100 <- Minus
chr3L 3221286..3221385 33..132 100 <- Minus
chr3L 3222331..3222361 1..32 93   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:13 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RD 1..435 40..474 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:12 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RD 1..435 40..474 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:00:39 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RE 1..435 40..474 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:28 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RD 1..435 40..474 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:27 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RE 1..435 40..474 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:38:29 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RA 1..545 2..545 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:12 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RB 1..32 2..32 96 -> Plus
RpL28-RB 172..684 33..545 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:00:39 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RA 2..547 1..545 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:28 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RA 1..545 2..545 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:27 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
RpL28-RA 2..547 1..545 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:27 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3221114..3221283 376..545 99 <- Minus
3L 3221467..3221709 133..375 100 <- Minus
3L 3221882..3221981 33..132 100 <- Minus
3L 3222927..3222957 1..32 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:27 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3221114..3221283 376..545 99 <- Minus
3L 3221467..3221709 133..375 100 <- Minus
3L 3221882..3221981 33..132 100 <- Minus
3L 3222927..3222957 1..32 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:27 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3221114..3221283 376..545 99 <- Minus
3L 3221467..3221709 133..375 100 <- Minus
3L 3221882..3221981 33..132 100 <- Minus
3L 3222927..3222957 1..32 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:00:39 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3221114..3221283 376..545 99 <- Minus
arm_3L 3221467..3221709 133..375 100 <- Minus
arm_3L 3221882..3221981 33..132 100 <- Minus
arm_3L 3222927..3222957 1..32 93   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:30 Download gff for RE52852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3221467..3221709 133..375 100 <- Minus
3L 3221882..3221981 33..132 100 <- Minus
3L 3222927..3222957 1..32 93   Minus
3L 3221114..3221283 376..545 99 <- Minus

RE52852.hyp Sequence

Translation from 3 to 473

> RE52852.hyp
LSFLYFNEKRREMATSSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLAS
VSSYRYSGIVHKKTLGVVPAADKKGFTAVLKKGKYAQRPAKNTVRVDFKA
GPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGKKAEFA
KGKKPE*

RE52852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpL28-PG 144 CG12740-PG 1..144 13..156 726 100 Plus
RpL28-PF 144 CG12740-PF 1..144 13..156 726 100 Plus
RpL28-PE 144 CG12740-PE 1..144 13..156 726 100 Plus
RpL28-PD 144 CG12740-PD 1..144 13..156 726 100 Plus
RpL28-PA 144 CG12740-PA 1..144 13..156 726 100 Plus

RE52852.pep Sequence

Translation from 39 to 473

> RE52852.pep
MATSSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHK
KTLGVVPAADKKGFTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNL
LIGSKYRKDLTQAALRRASAVLRSQKPAPVKGKKAEFAKGKKPE*

RE52852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24379-PA 144 GF24379-PA 1..144 1..144 718 97.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14270-PA 144 GG14270-PA 1..144 1..144 727 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15706-PA 144 GH15706-PA 1..144 1..144 623 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
RpL28-PG 144 CG12740-PG 1..144 1..144 726 100 Plus
RpL28-PF 144 CG12740-PF 1..144 1..144 726 100 Plus
RpL28-PE 144 CG12740-PE 1..144 1..144 726 100 Plus
RpL28-PD 144 CG12740-PD 1..144 1..144 726 100 Plus
RpL28-PA 144 CG12740-PA 1..144 1..144 726 100 Plus
RpL28-PB 144 CG12740-PB 1..144 1..144 726 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12761-PA 144 GI12761-PA 1..144 1..144 654 89.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21281-PA 144 GL21281-PA 1..144 1..144 706 95.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11782-PA 144 GA11782-PA 1..144 1..144 706 95.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14063-PA 144 GM14063-PA 1..144 1..144 734 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13338-PA 144 GD13338-PA 1..144 1..144 728 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15527-PA 144 GJ15527-PA 1..144 1..144 645 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16691-PA 134 GK16691-PA 1..132 1..132 645 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20698-PA 144 GE20698-PA 1..144 1..144 727 99.3 Plus