Clone RE53107 Report

Search the DGRC for RE53107

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:531
Well:7
Vector:pFlc-1
Associated Gene/TranscriptCG12817-RA
Protein status:RE53107.pep: validated full length
Preliminary Size:507
Sequenced Size:1127

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12817 2002-01-01 Sim4 clustering to Release 2
CG12817 2002-01-03 Blastp of sequenced clone
CG12817 2003-01-01 Sim4 clustering to Release 3
CG12817 2008-04-29 Release 5.5 accounting
CG12817 2008-08-15 Release 5.9 accounting
CG12817 2008-12-18 5.12 accounting

Clone Sequence Records

RE53107.complete Sequence

1127 bp (1127 high quality bases) assembled on 2002-01-03

GenBank Submission: AY084179

> RE53107.complete
GGAAATATACACAAAACCCGAACTCAACACACAACAATTTCCTGCAAAAT
TCACTTCACAATGTATAGGATGTGCAATCTATCGAATCTGCTGAATTTCA
TCATCTGCATAGCCAGCTTCAGCCAAAACTTCGATGCAACTCTGGCGGTC
AAGAGGGGTCCACATCATCCGAGGGGCGAAACCAGGAGGGTGGACCAGCA
TCTCACCCATGAGGAGCAGTAAGTGGGGGGCAGTAACGCAAATGTTGTAA
AAATTTGAATAATATTTCTATATTTTAGTCGCATTGATGACGATTTGAAG
GACATGGGCGTCCAGGCAAATTTAGATGATTTGAGTGAGGAGGAGAAAAT
CTTCTATATGTTTAAGGCCCATGACAATGATAATAACAATGCACTGGACG
GCCTCGAAATGATTCAGTCTGCCATGCATCATAACTATGACTATTTCAAA
AACAACGAGCGGGATGCATACCTACAAAATGCCACCGATGAGCTGGAGCA
CTTTATAGAGGCAATTGATAAATTTCTGCTGATTGCCGACGACAATAACG
ATGGCCTGCTGCATTACCCGGAATTCGTGAAGGCAATTACCGGTGGCAAG
GAGCAGCCGAATGTGGACAGGAATATCCTGCGCTAATCCCTCCAAGATCC
CGACTAACAGTACTCAACCAAACAGCCGAAGTAGACACAATAATAGTCAT
AGCATAGTTAAATTTTGTAGCAACTAATCTGATTTCCAAGCTGAACCATT
TGAGACTGTAATACCGCAAGCAAAAGAAAACCAAGCACTTGACTGCACCC
CGTTTGTAATACAACCTAATGATTTAATATACATTTTAATAGATACATAA
ATAAGAGTGCATTTTGCTTTGGAATCTTTAAAGCAATCCGTCACAGGTCT
GGGTCGTGTTGCAGGCCACTCCTCGGAAGCCATCGTAGGCGGCTCGCTCC
ATCAGGACGATGAGGTCGTTGTAGCGCGGCTTCTCCAGCGGCACTCTGTG
GATTAGTTAGAACCAGATTAATACTTAATATAACACAGCGATATCTCAAG
TTATCACCTGTAATAGTTTTTAACAAATTTTTTTTAATAAAGTTTGCACT
TATCAATTAGGAAAAAAAAAAAAAAAA

RE53107.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG12817-RA 1111 CG12817-RA 3..1111 3..1111 5530 99.9 Plus
CG12817.b 1055 CG12817.b 223..1055 279..1111 4165 100 Plus
CG12817.a 1219 CG12817.a 611..1219 503..1111 3030 99.8 Plus
CG12817.a 1219 CG12817.a 3..508 3..508 2515 99.8 Plus
CG12817.b 1055 CG12817.b 3..222 3..222 1085 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6049170..6049778 1111..503 3030 99.8 Minus
chr3R 27901430 chr3R 6050079..6050443 367..3 1810 99.7 Minus
chr3R 27901430 chr3R 6049880..6050023 508..365 705 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10223438..10224048 1113..503 3040 99.8 Minus
3R 32079331 3R 10224350..10224714 367..3 1810 99.7 Minus
3R 32079331 3R 10224151..10224294 508..365 720 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9964269..9964879 1113..503 3040 99.8 Minus
3R 31820162 3R 9965181..9965545 367..3 1810 99.7 Minus
3R 31820162 3R 9964982..9965125 508..365 720 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:37:22 has no hits.

RE53107.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:38:28 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6049170..6049772 509..1111 100 <- Minus
chr3R 6049880..6050021 367..508 99 <- Minus
chr3R 6050080..6050445 1..366 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:24 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 159..516 279..636 100   Plus
CG12817-RB 1..158 61..218 99 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:55:23 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 1..158 61..218 99 == Plus
CG12817-RB 159..516 279..636 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:33:21 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 1..158 61..218 99 == Plus
CG12817-RB 159..516 279..636 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:20:18 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 1..158 61..218 99 == Plus
CG12817-RB 159..516 279..636 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:08 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 159..516 279..636 100   Plus
CG12817-RB 1..158 61..218 99 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:19:11 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RA 1..1111 2..1111 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:55:22 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 1..212 7..218 99 == Plus
CG12817-RB 213..785 279..851 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:33:21 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 10..227 1..218 99 == Plus
CG12817-RB 228..1060 279..1111 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:20:19 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RA 1..1111 2..1111 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:08 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
CG12817-RB 10..227 1..218 99 == Plus
CG12817-RB 228..1060 279..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:28 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224151..10224292 367..508 100 <- Minus
3R 10223440..10224042 509..1111 100 <- Minus
3R 10224351..10224716 1..366 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:28 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224151..10224292 367..508 100 <- Minus
3R 10223440..10224042 509..1111 100 <- Minus
3R 10224351..10224716 1..366 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:28 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224151..10224292 367..508 100 <- Minus
3R 10223440..10224042 509..1111 100 <- Minus
3R 10224351..10224716 1..366 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:33:21 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6049162..6049764 509..1111 100 <- Minus
arm_3R 6049873..6050014 367..508 100 <- Minus
arm_3R 6050073..6050438 1..366 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:54:48 Download gff for RE53107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9964271..9964873 509..1111 100 <- Minus
3R 9964982..9965123 367..508 100 <- Minus
3R 9965182..9965547 1..366 99   Minus

RE53107.pep Sequence

Translation from 303 to 635

> RE53107.pep
MGVQANLDDLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAMHHNYDYFKN
NERDAYLQNATDELEHFIEAIDKFLLIADDNNDGLLHYPEFVKAITGGKE
QPNVDRNILR*

RE53107.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17532-PA 168 GF17532-PA 59..168 1..110 537 92.7 Plus
Dana\GF18309-PA 280 GF18309-PA 155..248 1..92 139 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17293-PA 171 GG17293-PA 62..171 1..110 563 98.2 Plus
Dere\GG15114-PA 280 GG15114-PA 156..251 1..94 152 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18456-PA 168 GH18456-PA 59..168 1..110 504 84.5 Plus
Dgri\GH15949-PA 278 GH15949-PA 157..252 1..94 152 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12817-PB 171 CG12817-PB 62..171 1..110 584 100 Plus
CG17271-PA 281 CG17271-PA 155..250 1..94 162 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24033-PA 168 GI24033-PA 59..168 1..110 493 82.7 Plus
Dmoj\GI22155-PA 259 GI22155-PA 141..236 1..94 152 37.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23837-PA 186 GL23837-PA 59..162 1..104 517 94.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27071-PA 168 GA27071-PA 59..168 1..110 547 94.5 Plus
Dpse\GA30097-PB 266 GA30097-PB 142..237 1..94 151 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26177-PA 171 GM26177-PA 62..171 1..110 565 99.1 Plus
Dsec\GM23156-PA 279 GM23156-PA 156..251 1..94 153 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20031-PA 276 GD20031-PA 153..248 1..94 153 37.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23663-PA 168 GJ23663-PA 59..168 1..110 502 85.5 Plus
Dvir\GJ24273-PA 270 GJ24273-PA 148..243 1..94 151 37.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22533-PA 168 GK22533-PA 59..168 1..110 504 86.4 Plus
Dwil\GK22695-PA 258 GK22695-PA 139..232 1..92 140 36.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24694-PA 171 GE24694-PA 62..171 1..110 561 98.2 Plus
Dyak\GE25036-PA 284 GE25036-PA 163..258 1..94 152 37.5 Plus

RE53107.hyp Sequence

Translation from 303 to 635

> RE53107.hyp
MGVQANLDDLSEEEKIFYMFKAHDNDNNNALDGLEMIQSAMHHNYDYFKN
NERDAYLQNATDELEHFIEAIDKFLLIADDNNDGLLHYPEFVKAITGGKE
QPNVDRNILR*

RE53107.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12817-PB 171 CG12817-PB 62..171 1..110 584 100 Plus
CG17271-PA 281 CG17271-PA 155..250 1..94 162 37.5 Plus