Clone RE53289 Report

Search the DGRC for RE53289

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:532
Well:89
Vector:pFlc-1
Associated Gene/TranscriptTpnC25D-RA
Protein status:RE53289.pep: gold
Preliminary Size:497
Sequenced Size:655

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6514 2002-01-01 Sim4 clustering to Release 2
CG6514 2002-04-21 Blastp of sequenced clone
CG6514 2003-01-01 Sim4 clustering to Release 3
TpnC25D 2008-04-29 Release 5.5 accounting
TpnC25D 2008-08-15 Release 5.9 accounting
TpnC25D 2008-12-18 5.12 accounting

Clone Sequence Records

RE53289.complete Sequence

655 bp (655 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113496

> RE53289.complete
AGTGCGCGCCCGCAGGCCAACGCAGTTGGAACGCATTGGAGATTGGAATA
CTCGCTCGCTCGCAAATTGTCGTTTGGCCAACAGATACAAAATGGAGGAC
GACGAGAAAATGGACATCATGCGCAAGGCATTCCAAATGTTCGACACACA
AAAGACGGGCTTCATTGAGACGCTGCGTCTGAAGACGATCCTCAACAGCA
TGGGTCAGATGTTCGACGATAGCGAACTGCAGGCTCTGATCGACGACAAC
GATCCGGAGGACACCGGCAAGGTTAACTTCGACGGCTTCTGCAGCATCGC
TGCCCATTTCCTGGAAGAGGAGGATGCCGAGGCCATCCAGAAGGAGCTGA
AAGAGGCCTTTCGTCTGTACGATCGCGAGGGAAATGGTTACATCACCACC
TCAACGCTGAAGGAAATTCTCGCCGCCCTCGACGACAAGCTCTCCTCCAG
CGATCTGGACGGCATCATCGCTGAGATTGACACTGATGGATCCGGTACCG
TGGACTTTGATGAATTCATGGAGATGATGGCGGGCGAGTAGAAAAACCAC
GAACGCTGATAAAACCAACAGAAAATCGAGCTTTTGGGTTTAATTATAAT
TTTTTATTATTTTTAAATAAATTAACTAACCGCTTTAATAAAAAAAAAAA
AAAAA

RE53289.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC25D-RA 1072 TpnC25D-RA 428..1072 1..645 3210 99.8 Plus
TpnC25D.a 620 TpnC25D.a 68..620 93..645 2750 99.8 Plus
TpnC25D.c 688 TpnC25D.c 137..688 94..645 2745 99.8 Plus
TpnC25D.c 688 TpnC25D.c 6..100 1..95 475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5217546..5217964 94..512 2095 100 Plus
chr2L 23010047 chr2L 5218026..5218153 512..639 640 100 Plus
chr2L 23010047 chr2L 5217360..5217454 1..95 475 100 Plus
chr2R 21145070 chr2R 7162134..7162256 421..299 195 77.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5218446..5218864 94..512 2095 100 Plus
2L 23513712 2L 5218926..5219059 512..645 655 99.3 Plus
2L 23513712 2L 5218260..5218354 1..95 475 100 Plus
2R 25286936 2R 11274671..11274793 421..299 195 77.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5218446..5218864 94..512 2095 100 Plus
2L 23513712 2L 5218926..5219059 512..645 655 99.2 Plus
2L 23513712 2L 5218260..5218354 1..95 475 100 Plus
2R 25260384 2R 11275870..11275992 421..299 195 77.2 Minus
Blast to na_te.dros performed on 2019-03-15 14:24:00 has no hits.

RE53289.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:25:12 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5217360..5217453 1..94 100 -> Plus
chr2L 5217547..5217964 95..512 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:34 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..450 92..541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:46 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..450 92..541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:27:27 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..450 92..541 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:06 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..450 92..541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:57:31 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..450 92..541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:36 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..639 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:45 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..639 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:27:27 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 6..644 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:06 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 1..639 1..639 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:57:31 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC25D-RA 7..645 1..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:25:12 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5218260..5218353 1..94 100 -> Plus
2L 5218447..5218864 95..512 100 -> Plus
2L 5218927..5219053 513..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:25:12 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5218260..5218353 1..94 100 -> Plus
2L 5218447..5218864 95..512 100 -> Plus
2L 5218927..5219053 513..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:25:12 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5218260..5218353 1..94 100 -> Plus
2L 5218447..5218864 95..512 100 -> Plus
2L 5218927..5219053 513..639 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:27:27 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5218260..5218353 1..94 100 -> Plus
arm_2L 5218447..5218864 95..512 100 -> Plus
arm_2L 5218927..5219053 513..639 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:12 Download gff for RE53289.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5218447..5218864 95..512 100 -> Plus
2L 5218927..5219053 513..639 100   Plus
2L 5218260..5218353 1..94 100 -> Plus

RE53289.hyp Sequence

Translation from 0 to 540

> RE53289.hyp
VRARRPTQLERIGDWNTRSLANCRLANRYKMEDDEKMDIMRKAFQMFDTQ
KTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFCSIA
AHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSS
DLDGIIAEIDTDGSGTVDFDEFMEMMAGE*

RE53289.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC25D-PC 149 CG6514-PC 1..149 31..179 758 100 Plus
TpnC25D-PA 149 CG6514-PA 1..149 31..179 758 100 Plus
TpnC25D-PB 143 CG6514-PB 1..143 37..179 726 100 Plus
TpnC47D-PB 155 CG9073-PB 11..155 35..179 425 58.6 Plus
TpnC47D-PA 155 CG9073-PA 11..155 35..179 425 58.6 Plus

RE53289.pep Sequence

Translation from 91 to 540

> RE53289.pep
MEDDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALI
DDNDPEDTGKVNFDGFCSIAAHFLEEEDAEAIQKELKEAFRLYDREGNGY
ITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGSGTVDFDEFMEMMAGE*

RE53289.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14383-PA 143 GF14383-PA 1..143 7..149 698 95.1 Plus
Dana\GF12423-PA 155 GF12423-PA 11..155 5..149 418 57.9 Plus
Dana\GF10103-PA 155 GF10103-PA 11..155 5..149 412 57.2 Plus
Dana\GF11155-PA 109 GF11155-PA 16..105 60..149 410 87.8 Plus
Dana\GF13927-PA 173 GF13927-PA 31..170 9..148 409 57.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25060-PA 143 GG25060-PA 1..143 7..149 729 100 Plus
Dere\GG22682-PA 155 GG22682-PA 11..155 5..149 415 58.6 Plus
Dere\GG13604-PA 155 GG13604-PA 11..155 5..149 412 57.2 Plus
Dere\GG10878-PA 289 GG10878-PA 143..286 5..148 407 56.2 Plus
Dere\GG10858-PA 158 GG10858-PA 7..153 3..148 392 54.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21490-PA 143 GH21490-PA 1..143 7..149 706 96.5 Plus
Dgri\GH21939-PA 154 GH21939-PA 10..154 5..149 413 57.9 Plus
Dgri\GH21731-PA 152 GH21731-PA 6..149 5..148 412 56.2 Plus
Dgri\GH16402-PA 155 GH16402-PA 11..155 5..149 409 56.6 Plus
Dgri\GH21732-PA 154 GH21732-PA 7..153 3..148 377 52.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC25D-PC 149 CG6514-PC 1..149 1..149 758 100 Plus
TpnC25D-PA 149 CG6514-PA 1..149 1..149 758 100 Plus
TpnC25D-PB 143 CG6514-PB 1..143 7..149 726 100 Plus
TpnC47D-PB 155 CG9073-PB 11..155 5..149 425 58.6 Plus
TpnC47D-PA 155 CG9073-PA 11..155 5..149 425 58.6 Plus
TpnC41C-PB 154 CG2981-PB 8..151 5..148 423 56.2 Plus
TpnC41C-PA 154 CG2981-PA 8..151 5..148 423 56.2 Plus
TpnC73F-PC 155 CG7930-PC 11..155 5..149 420 57.2 Plus
TpnC73F-PA 155 CG7930-PA 11..155 5..149 420 57.2 Plus
TpnC4-PB 153 CG12408-PB 7..153 3..148 394 54.4 Plus
TpnC4-PA 153 CG12408-PA 7..153 3..148 394 54.4 Plus
Cam-PD 149 CG8472-PD 7..149 4..149 270 34.2 Plus
Cam-PC 149 CG8472-PC 7..149 4..149 270 34.2 Plus
Cam-PE 149 CG8472-PE 7..149 4..149 270 34.2 Plus
Cam-PB 149 CG8472-PB 7..149 4..149 270 34.2 Plus
Cam-PA 149 CG8472-PA 7..149 4..149 270 34.2 Plus
Acam-PB 148 CG17769-PB 6..146 4..147 260 34.7 Plus
Acam-PA 148 CG17769-PA 6..146 4..147 260 34.7 Plus
CG11638-PA 387 CG11638-PA 210..355 6..146 247 34.2 Plus
CG31960-PA 148 CG31960-PA 7..145 5..146 240 30.3 Plus
azot-PA 148 CG11165-PA 1..145 1..146 234 32.4 Plus
CG17493-PD 182 CG17493-PD 35..176 1..146 202 30.8 Plus
CG17493-PC 182 CG17493-PC 35..176 1..146 202 30.8 Plus
CG17493-PB 182 CG17493-PB 35..176 1..146 202 30.8 Plus
CG31802-PA 186 CG31802-PA 43..180 5..146 200 30.3 Plus
CG30378-PA 148 CG30378-PA 7..146 4..146 194 25.2 Plus
CG17770-PA 164 CG17770-PA 22..162 4..147 173 26.9 Plus
CG13526-PA 154 CG13526-PA 11..150 4..146 159 25.2 Plus
Eip63F-1-PB 161 CG15855-PB 1..160 1..146 150 24.1 Plus
sqh-PE 174 CG3595-PE 27..164 1..146 150 27.4 Plus
sqh-PD 174 CG3595-PD 27..164 1..146 150 27.4 Plus
sqh-PC 174 CG3595-PC 27..164 1..146 150 27.4 Plus
sqh-PB 174 CG3595-PB 27..164 1..146 150 27.4 Plus
sqh-PA 174 CG3595-PA 27..164 1..146 150 27.4 Plus
Mlc-c-PA 147 CG3201-PA 6..144 4..146 147 21.7 Plus
Eip63F-1-PD 166 CG15855-PD 13..165 10..146 147 23.5 Plus
Eip63F-1-PC 181 CG15855-PC 28..180 10..146 147 23.5 Plus
Eip63F-1-PA 193 CG15855-PA 40..192 10..146 147 23.5 Plus
CG13898-PA 151 CG13898-PA 8..145 1..142 146 23.9 Plus
Mlc-c-PB 153 CG3201-PB 15..150 7..146 146 22.1 Plus
CG5024-PB 165 CG5024-PB 22..162 3..146 142 22.2 Plus
CG5024-PA 165 CG5024-PA 22..162 3..146 142 22.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24238-PA 143 GI24238-PA 1..143 7..149 697 94.4 Plus
Dmoj\GI19647-PA 155 GI19647-PA 11..155 5..149 415 57.9 Plus
Dmoj\GI18874-PA 186 GI18874-PA 40..183 5..148 414 56.2 Plus
Dmoj\GI12482-PA 155 GI12482-PA 11..155 5..149 412 57.2 Plus
Dmoj\GI18875-PA 220 GI18875-PA 11..155 3..146 404 55.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19565-PA 149 GL19565-PA 1..149 1..149 745 97.3 Plus
Dper\GL11049-PA 207 GL11049-PA 61..204 5..148 415 56.2 Plus
Dper\GL16748-PA 155 GL16748-PA 11..155 5..149 409 57.2 Plus
Dper\GL11919-PA 155 GL11919-PA 11..155 5..149 405 55.9 Plus
Dper\GL15651-PA 422 GL15651-PA 274..420 3..148 383 52.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\TpnCII-PA 149 GA19654-PA 1..149 1..149 745 97.3 Plus
Dpse\TpnCIb-PA 155 GA21520-PA 11..155 5..149 409 57.2 Plus
Dpse\TpnCIa-PA 155 GA23964-PA 11..155 5..149 405 55.9 Plus
Dpse\TpnCIIIb-PA 174 GA11615-PA 26..172 3..148 376 52.4 Plus
Dpse\TpnCIIIa-PA 70 GA27673-PA 1..67 82..148 250 73.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18540-PA 143 GM18540-PA 1..143 7..149 729 100 Plus
Dsec\GM20459-PA 155 GM20459-PA 11..155 5..149 415 58.6 Plus
Dsec\GM25686-PA 155 GM25686-PA 11..155 5..149 412 57.2 Plus
Dsec\GM16508-PA 155 GM16508-PA 7..153 3..148 387 53.7 Plus
Dsec\GM21351-PA 149 GM21351-PA 7..147 4..147 247 34.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23329-PA 149 GD23329-PA 1..149 1..149 757 100 Plus
Dsim\TpnC47D-PA 155 GD25928-PA 11..155 5..149 415 58.6 Plus
Dsim\GD14691-PA 155 GD14691-PA 11..155 5..149 412 57.2 Plus
Dsim\GD16679-PA 154 GD16679-PA 8..151 5..148 409 56.2 Plus
Dsim\GD10357-PA 155 GD10357-PA 7..153 3..148 388 53.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TpnCII-PA 143 GJ21496-PA 1..143 7..149 698 95.1 Plus
Dvir\TpnCIb-PA 155 GJ15012-PA 11..155 5..149 417 57.9 Plus
Dvir\TpnCIa-PA 158 GJ12386-PA 14..158 5..149 412 57.2 Plus
Dvir\TpnCIIIa-PA 158 GJ21908-PA 12..155 5..148 411 56.2 Plus
Dvir\TpnCIIIb-PA 189 GJ21909-PA 6..152 3..148 394 53.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21094-PA 150 GK21094-PA 3..150 2..149 717 94.6 Plus
Dwil\GK21946-PA 557 GK21946-PA 409..555 3..148 418 55.1 Plus
Dwil\GK21627-PA 155 GK21627-PA 11..155 5..149 417 57.9 Plus
Dwil\GK15267-PA 155 GK15267-PA 11..155 5..149 413 57.2 Plus
Dwil\GK21371-PA 151 GK21371-PA 5..148 5..148 409 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25333-PA 143 GE25333-PA 1..143 7..149 726 99.3 Plus
Dyak\TpnC47D-PA 155 GE13037-PA 11..155 5..149 416 58.6 Plus
Dyak\GE19899-PA 155 GE19899-PA 11..155 5..149 412 57.2 Plus
Dyak\GE11315-PA 152 GE11315-PA 6..149 5..148 409 56.2 Plus
Dyak\TpnC4-PA 170 GE11292-PA 19..165 3..148 396 53.7 Plus