Clone RE53354 Report

Search the DGRC for RE53354

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:533
Well:54
Vector:pFlc-1
Associated Gene/TranscriptArf102F-RA
Protein status:RE53354.pep: gold
Preliminary Size:769
Sequenced Size:728

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11027 2001-12-14 Blastp of sequenced clone
CG11027 2002-01-01 Sim4 clustering to Release 2
CG11027 2003-01-01 Sim4 clustering to Release 3
Arf102F 2008-04-29 Release 5.5 accounting
Arf102F 2008-08-15 Release 5.9 accounting
Arf102F 2008-12-18 5.12 accounting

Clone Sequence Records

RE53354.complete Sequence

728 bp (728 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071450

> RE53354.complete
ATTAATCGAATGACTAGTTTACACGTCAATTTACTGAAGTTACTGAAGAC
AAGCTTTTTCCTATACGAAATAAAATAGTTTCTTATTAAACATGGGACTA
ACAATATCTAGTCTTTTGACACGTTTGTTTGGAAAAAAACAAATGCGTAT
TCTTATGGTTGGCTTGGATGCTGCTGGAAAAACGACTATTCTGTACAAAT
TAAAGCTGGGTGAAATTGTAACCACCATACCAACCATAGGCTTCAATGTC
GAGACTGTGGAATATAAGAATATATGTTTTACCGTTTGGGATGTTGGTGG
CCAAGACAAAATTCGCCCGTTGTGGCGACACTATTTCCAAAATACACAGG
GTCTTATATTTGTAGTGGATTCCAACGACCGCGATCGTATAACTGAAGCT
GAAAGAGAACTACAGAACATGCTCCAGGAGGATGAACTTAGGGACGCGGT
ACTTTTGGTTTTTGCCAACAAACAGGACCTACCGAATGCAATGACAGCTG
CCGAGCTTACGGACAAGTTGCGCCTTAACCAATTAAGGAATCGCCACTGG
TTTATTCAGTCTACATGTGCTACCCAAGGGCACGGTCTTTATGAAGGACT
TGATTGGCTATCAGCTGAATTGGCTAAAAAATAAAAATATTCCTTATATT
GTAAGATAGGAATTGCTGTTCTCGTATGCTGAAAACTAGATTTTAAATAA
ACTTGTAAATGCAAAAAAAAAAAAAAAA

RE53354.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Arf102F.d 1320 Arf102F.d 414..1124 1..711 3555 100 Plus
Arf102F.c 1283 Arf102F.c 59..769 1..711 3555 100 Plus
Arf102F-RA 983 Arf102F-RA 59..769 1..711 3555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 1144922..1145185 158..421 1320 100 Plus
chr4 1351717 chr4 1145437..1145600 548..711 820 100 Plus
chr4 1351717 chr4 1144661..1144818 1..158 790 100 Plus
chr4 1351717 chr4 1145254..1145380 421..547 635 100 Plus
chr3L 24539361 chr3L 22858582..22858693 348..237 305 84.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1124435..1124698 158..421 1320 100 Plus
4 1348131 4 1124950..1125113 548..711 820 100 Plus
4 1348131 4 1124174..1124331 1..158 790 100 Plus
4 1348131 4 1124767..1124893 421..547 635 100 Plus
3L 28110227 3L 22869666..22869777 348..237 305 84.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 1124435..1124698 158..421 1320 100 Plus
4 1331231 4 1124950..1125113 548..711 820 100 Plus
4 1331231 4 1124174..1124331 1..158 790 100 Plus
4 1331231 4 1124767..1124893 421..547 635 100 Plus
3L 28103327 3L 22862766..22862877 348..237 305 84.8 Minus
3L 28103327 3L 22862944..22863026 237..155 175 80.7 Minus
Blast to na_te.dros performed 2019-03-16 07:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 3090..3154 23..88 119 70.1 Plus

RE53354.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:38:53 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 1144661..1144818 1..158 100 -> Plus
chr4 1144923..1145185 159..421 100 -> Plus
chr4 1145255..1145380 422..547 100 -> Plus
chr4 1145437..1145600 548..712 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:36 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..543 92..634 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:52 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..543 92..634 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:33:39 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..543 92..634 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:04 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..543 92..634 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:39 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..543 92..634 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:55 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..711 1..712 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:52 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..711 1..712 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:33:39 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 8..718 1..712 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:04 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 1..711 1..712 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:39 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
Arf102F-RA 8..718 1..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:53 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
4 1124174..1124331 1..158 100 -> Plus
4 1124436..1124698 159..421 100 -> Plus
4 1124768..1124893 422..547 100 -> Plus
4 1124950..1125113 548..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:53 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
4 1124174..1124331 1..158 100 -> Plus
4 1124436..1124698 159..421 100 -> Plus
4 1124768..1124893 422..547 100 -> Plus
4 1124950..1125113 548..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:38:53 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
4 1124174..1124331 1..158 100 -> Plus
4 1124436..1124698 159..421 100 -> Plus
4 1124768..1124893 422..547 100 -> Plus
4 1124950..1125113 548..712 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:33:39 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1145394..1145519 422..547 100 -> Plus
arm_4 1145576..1145739 548..712 99   Plus
arm_4 1144800..1144957 1..158 100 -> Plus
arm_4 1145062..1145324 159..421 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:19 Download gff for RE53354.complete
Subject Subject Range Query Range Percent Splice Strand
4 1124436..1124698 159..421 100 -> Plus
4 1124768..1124893 422..547 100 -> Plus
4 1124950..1125113 548..712 99   Plus
4 1124174..1124331 1..158 100 -> Plus

RE53354.pep Sequence

Translation from 91 to 633

> RE53354.pep
MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
FNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRI
TEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLRLNQLRN
RHWFIQSTCATQGHGLYEGLDWLSAELAKK*

RE53354.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23416-PA 180 GF23416-PA 1..180 1..180 937 97.2 Plus
Dana\GF23441-PA 182 GF23441-PA 1..177 1..177 785 83.1 Plus
Dana\GF13030-PA 175 GF13030-PA 1..171 5..175 641 66.1 Plus
Dana\GF24106-PA 180 GF24106-PA 6..179 7..180 509 56.3 Plus
Dana\GF23565-PA 179 GF23565-PA 1..179 1..180 470 48.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16407-PA 180 GG16407-PA 1..180 1..180 953 99.4 Plus
Dere\GG13164-PA 182 GG13164-PA 1..177 1..177 785 83.1 Plus
Dere\GG20511-PA 175 GG20511-PA 1..171 5..175 638 66.1 Plus
Dere\GG15940-PA 190 GG15940-PA 16..189 7..180 508 56.3 Plus
Dere\GG15097-PA 179 GG15097-PA 1..179 1..180 471 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23951-PA 180 GH23951-PA 1..180 1..180 935 97.2 Plus
Dgri\GH14762-PA 182 GH14762-PA 1..177 1..177 785 83.1 Plus
Dgri\GH14763-PA 182 GH14763-PA 1..177 1..177 665 69.5 Plus
Dgri\GH20425-PA 175 GH20425-PA 1..171 5..175 640 66.1 Plus
Dgri\GH14778-PA 180 GH14778-PA 6..179 7..180 509 56.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Arf102F-PB 180 CG11027-PB 1..180 1..180 932 100 Plus
Arf102F-PA 180 CG11027-PA 1..180 1..180 932 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..177 1..177 767 83.1 Plus
Arf79F-PI 182 CG8385-PI 1..177 1..177 767 83.1 Plus
Arf79F-PH 182 CG8385-PH 1..177 1..177 767 83.1 Plus
Arf79F-PF 182 CG8385-PF 1..177 1..177 767 83.1 Plus
Arf79F-PC 182 CG8385-PC 1..177 1..177 767 83.1 Plus
Arf79F-PE 182 CG8385-PE 1..177 1..177 767 83.1 Plus
Arf79F-PB 182 CG8385-PB 1..177 1..177 767 83.1 Plus
Arf79F-PA 182 CG8385-PA 1..177 1..177 767 83.1 Plus
Arf51F-PE 175 CG8156-PE 1..171 5..175 624 66.1 Plus
Arf51F-PA 175 CG8156-PA 1..171 5..175 624 66.1 Plus
Arf51F-PC 175 CG8156-PC 1..171 5..175 624 66.1 Plus
Arf51F-PB 175 CG8156-PB 1..171 5..175 624 66.1 Plus
Arf51F-PD 175 CG8156-PD 1..171 5..175 624 66.1 Plus
Arl1-PA 180 CG6025-PA 4..179 5..180 497 55.7 Plus
Arl5-PA 179 CG7197-PA 1..179 1..180 462 48.9 Plus
dnd-PA 179 CG6560-PA 15..179 15..179 426 49.1 Plus
Arl2-PA 184 CG7435-PA 14..179 15..180 410 45.8 Plus
Arl4-PA 312 CG2219-PA 14..162 7..150 346 47 Plus
Arl4-PB 313 CG2219-PB 26..163 18..150 342 49.3 Plus
Arl8-PC 186 CG7891-PC 15..177 12..173 270 30.7 Plus
Arl8-PB 186 CG7891-PB 15..177 12..173 270 30.7 Plus
Arl8-PA 186 CG7891-PA 15..177 12..173 270 30.7 Plus
Arl6-PA 202 CG7735-PA 15..183 15..177 267 34.3 Plus
Arl6-PB 201 CG7735-PB 15..182 15..177 266 34.5 Plus
Arfrp1-PA 200 CG7039-PA 20..183 20..173 258 34.3 Plus
Sar1-PE 193 CG7073-PE 18..189 15..174 250 33.3 Plus
Sar1-PC 193 CG7073-PC 18..189 15..174 250 33.3 Plus
Sar1-PD 193 CG7073-PD 18..189 15..174 250 33.3 Plus
Sar1-PA 193 CG7073-PA 18..189 15..174 250 33.3 Plus
CG17819-PA 186 CG17819-PA 17..181 14..177 214 31.4 Plus
Arl4-PC 100 CG2219-PC 14..93 7..81 212 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14031-PA 180 GI14031-PA 1..180 1..180 945 98.3 Plus
Dmoj\GI11864-PA 182 GI11864-PA 1..177 1..177 785 83.1 Plus
Dmoj\GI19608-PA 175 GI19608-PA 1..171 5..175 640 66.1 Plus
Dmoj\GI11881-PA 180 GI11881-PA 4..179 5..180 509 55.7 Plus
Dmoj\GI15002-PA 196 GI15002-PA 1..173 1..173 507 53.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18404-PA 180 GL18404-PA 1..180 1..180 941 97.8 Plus
Dper\GL25178-PA 182 GL25178-PA 1..177 1..177 785 83.1 Plus
Dper\GL24385-PA 181 GL24385-PA 1..176 1..177 654 71.3 Plus
Dper\GL17751-PA 175 GL17751-PA 1..171 5..175 633 64.9 Plus
Dper\GL12747-PA 180 GL12747-PA 6..179 7..180 509 56.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10714-PA 180 GA10714-PA 1..180 1..180 941 97.8 Plus
Dpse\GA21036-PA 182 GA21036-PA 1..177 1..177 785 83.1 Plus
Dpse\GA23613-PA 181 GA23613-PA 1..176 1..177 654 71.3 Plus
Dpse\GA20856-PA 175 GA20856-PA 1..171 5..175 633 64.9 Plus
Dpse\GA19306-PA 180 GA19306-PA 6..179 7..180 509 56.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13026-PA 180 GM13026-PA 1..180 1..180 955 100 Plus
Dsec\GM22073-PA 182 GM22073-PA 1..177 1..177 785 83.1 Plus
Dsec\GM21603-PA 175 GM21603-PA 1..171 5..175 638 66.1 Plus
Dsec\GM25571-PA 180 GM25571-PA 6..179 7..180 509 56.3 Plus
Dsec\GM24953-PA 179 GM24953-PA 1..179 1..180 471 48.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20493-PA 180 GD20493-PA 1..180 1..180 955 100 Plus
Dsim\GD12049-PA 182 GD12049-PA 1..177 1..177 785 83.1 Plus
Dsim\GD11108-PA 175 GD11108-PA 1..171 5..175 638 66.1 Plus
Dsim\GD14586-PA 180 GD14586-PA 6..179 7..180 509 56.3 Plus
Dsim\GD13004-PA 179 GD13004-PA 1..179 1..180 471 48.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19602-PA 180 GJ19602-PA 1..180 1..180 945 98.3 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 1..177 1..177 785 83.1 Plus
Dvir\GJ14973-PA 175 GJ14973-PA 1..171 5..175 640 66.1 Plus
Dvir\GJ13575-PA 180 GJ13575-PA 4..179 5..180 509 55.7 Plus
Dvir\GJ15360-PA 193 GJ15360-PA 1..172 1..173 504 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13623-PA 180 GK13623-PA 1..180 1..180 937 97.2 Plus
Dwil\GK20496-PA 182 GK20496-PA 1..177 1..177 785 83.1 Plus
Dwil\GK20891-PA 175 GK20891-PA 1..171 5..175 639 66.1 Plus
Dwil\GK24495-PA 167 GK24495-PA 1..166 15..180 498 57.2 Plus
Dwil\GK17000-PA 179 GK17000-PA 1..179 1..180 469 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Arf102F-PA 180 GE14567-PA 1..180 1..180 940 98.3 Plus
Dyak\GE19486-PA 182 GE19486-PA 1..177 1..177 785 83.1 Plus
Dyak\GE13644-PA 175 GE13644-PA 1..171 5..175 638 66.1 Plus
Dyak\GE22880-PA 180 GE22880-PA 6..179 7..180 509 56.3 Plus
Dyak\GE21319-PA 179 GE21319-PA 1..179 1..180 471 48.9 Plus

RE53354.hyp Sequence

Translation from 91 to 633

> RE53354.hyp
MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
FNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRI
TEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKLRLNQLRN
RHWFIQSTCATQGHGLYEGLDWLSAELAKK*

RE53354.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Arf102F-PB 180 CG11027-PB 1..180 1..180 932 100 Plus
Arf102F-PA 180 CG11027-PA 1..180 1..180 932 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..177 1..177 767 83.1 Plus
Arf79F-PI 182 CG8385-PI 1..177 1..177 767 83.1 Plus
Arf79F-PH 182 CG8385-PH 1..177 1..177 767 83.1 Plus