Clone RE53745 Report

Search the DGRC for RE53745

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:537
Well:45
Vector:pFlc-1
Associated Gene/TranscriptMst85C-RA
Protein status:RE53745.pep: gold
Preliminary Size:833
Sequenced Size:1365

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11993 2001-12-14 Blastp of sequenced clone
CG11993 2002-01-01 Sim4 clustering to Release 2
CG11993 2003-01-01 Sim4 clustering to Release 3
Mst85C 2008-04-29 Release 5.5 accounting
Mst85C 2008-08-15 Release 5.9 accounting
Mst85C 2008-12-18 5.12 accounting

Clone Sequence Records

RE53745.complete Sequence

1365 bp (1365 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071454

> RE53745.complete
GCCAACGCCATCTGGCCACACTGCAGTGAAAAGGAAAACAAGAAGTCGCA
AATCCAATCTCCATTGCAATTTTGAACACCATTCCTTTGCATAACTATTG
CCCACGCAACTGCATCTCTGATGCCCACAGACTGGCGATGAAGCCCCAGA
GCAAGCGGAAATCATTCCCATTCAATGCGCCTCCTCCGGGCGGTATCATG
GACTTCGGATTCGGGAGCTGCAGCACCTTCGGCAATTCGGTGGAGAATGA
TCTGGTAAAATGGCAGCATAAGCGAAAATCCGAGCAGCCGGCACCGGCAG
TGCTACCACCCAAAATGCTTATAACCGAGGAGAGGATCACCCAGCATTTC
AGCGGTCTATCGCTGGATCCGAAGATCAATGTCGCCGCCACGGCCGTTGT
TAGCAACAACAACAGCGTGGCCAGCGTTACGGGCGGACTGGCCACGGATG
ATATACCATCCACCAGCACCGGGAAGACCCACCACCCCAATCCCGCCTAT
CAAATGGCGGCCATGGAACTGGAGCAGAAACTGCGCAATGCCAATCGCAT
CGTAATTTGTGATGGCCTTAAGCCAGGATCGGGTCCCGGTTCCGCTCCAC
CTGTAATACCACCGGAGTGGCTAATCAAGTCCATACCACGTCCCTGCACC
GCCTTGGTCCCTTGGCAGCCTTCGCCACTGCAGATGCCGATGCCGATGCC
GGAAGTCAAGATGGTGTCGCCCCAAATAGTGGCACCCATGGCTGCGGCAC
CGGCGGTCCAGGAGCTGGATGACTACGATGACGATCTGGAGTTCTTCGAG
AACAACAACACGTGCAGCGTGAATCTTAACAAGTCTGAGCAGGAGCACAT
GGACGAAGACCTGTAGCGATAGCCATATAAAACCCTAAACCATAAGCATT
AAAGTGTAGATTTGTATGTCCGTAACCGTAAGAACCCAGTTGATAGCATG
CAAGAATACTCCGCCTCCTTATTTTTTTATTACTATTGAAAATAGATAGA
TGTATGTGATTCAATCTGGAATGTTCCGGAATATTCGTTATTTGAAGCAA
GTGAGTCGAGAACAGATAACTTTCGAGAGACGCAACGGCGGACGTCAAAC
GAACACCTGACTTAAGAAAAGTTTTTCTAAGATGAACTAATTCATTTTAC
TTTTTACATCAATTTATAAGCACTTTTTACAGTATATGAGTTTCTGCAGT
AAAGTGGATCGAACGAGCTGAATCTACCATATTGTTTAAAATATACTTTA
CATTGCGTTTTTGGAATCGACCTTTCTTTGCTGGCTACTAAAATTAGAAA
GATACGTATTTTTTGCAATTGATAAAGAATAAAGAATAAAACTGTAAGCA
AAAAAAAAAAAAAAA

RE53745.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Mst85C-RA 1556 Mst85C-RA 162..1514 1..1353 6765 100 Plus
Mst85C.a 1397 Mst85C.a 133..1355 131..1353 6115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4877081..4878125 305..1349 5180 99.7 Plus
chr3R 27901430 chr3R 4876718..4877021 1..304 1520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9051187..9052235 305..1353 5245 100 Plus
3R 32079331 3R 9050824..9051127 1..304 1520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8792018..8793066 305..1353 5245 100 Plus
3R 31820162 3R 8791655..8791958 1..304 1520 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:34:24 has no hits.

RE53745.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:35:27 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4876718..4877021 1..304 100 -> Plus
chr3R 4877081..4878125 305..1349 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:47 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..729 138..866 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:05 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..729 138..866 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:29:19 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..729 138..866 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:44 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..729 138..866 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:48:05 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..729 138..866 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:49 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..1349 1..1349 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:05 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..1349 1..1349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:29:19 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 4..1352 1..1349 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:44 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 1..1349 1..1349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:48:05 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
Mst85C-RA 4..1352 1..1349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:27 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9050824..9051127 1..304 100 -> Plus
3R 9051187..9052231 305..1349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:27 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9050824..9051127 1..304 100 -> Plus
3R 9051187..9052231 305..1349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:27 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9050824..9051127 1..304 100 -> Plus
3R 9051187..9052231 305..1349 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:29:19 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4876546..4876849 1..304 100 -> Plus
arm_3R 4876909..4877953 305..1349 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:50 Download gff for RE53745.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8791655..8791958 1..304 100 -> Plus
3R 8792018..8793062 305..1349 100   Plus

RE53745.pep Sequence

Translation from 137 to 865

> RE53745.pep
MKPQSKRKSFPFNAPPPGGIMDFGFGSCSTFGNSVENDLVKWQHKRKSEQ
PAPAVLPPKMLITEERITQHFSGLSLDPKINVAATAVVSNNNSVASVTGG
LATDDIPSTSTGKTHHPNPAYQMAAMELEQKLRNANRIVICDGLKPGSGP
GSAPPVIPPEWLIKSIPRPCTALVPWQPSPLQMPMPMPEVKMVSPQIVAP
MAAAPAVQELDDYDDDLEFFENNNTCSVNLNKSEQEHMDEDL*

RE53745.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16579-PA 249 GF16579-PA 1..249 1..242 797 73.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14871-PA 240 GG14871-PA 1..240 1..242 1169 95 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19345-PA 283 GH19345-PA 43..283 13..242 606 61.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Mst85C-PB 242 CG11993-PB 1..242 1..242 1290 100 Plus
Mst85C-PA 242 CG11993-PA 1..242 1..242 1290 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22555-PA 274 GI22555-PA 42..274 13..242 645 62.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12119-PA 118 GL12119-PA 1..118 123..242 294 73.8 Plus
Dper\GL12118-PA 84 GL12118-PA 1..84 1..90 232 59.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11318-PA 239 GA11318-PA 1..239 1..242 683 70.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23782-PA 240 GM23782-PA 1..240 1..242 1228 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18593-PA 118 GD18593-PA 1..118 123..242 587 95 Plus
Dsim\GD18592-PA 68 GD18592-PA 1..65 21..85 333 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23744-PA 268 GJ23744-PA 42..268 13..242 668 65.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13224-PA 265 GK13224-PA 28..265 2..242 550 58.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25926-PA 240 GE25926-PA 1..240 1..242 1156 93.4 Plus

RE53745.hyp Sequence

Translation from 137 to 865

> RE53745.hyp
MKPQSKRKSFPFNAPPPGGIMDFGFGSCSTFGNSVENDLVKWQHKRKSEQ
PAPAVLPPKMLITEERITQHFSGLSLDPKINVAATAVVSNNNSVASVTGG
LATDDIPSTSTGKTHHPNPAYQMAAMELEQKLRNANRIVICDGLKPGSGP
GSAPPVIPPEWLIKSIPRPCTALVPWQPSPLQMPMPMPEVKMVSPQIVAP
MAAAPAVQELDDYDDDLEFFENNNTCSVNLNKSEQEHMDEDL*

RE53745.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Mst85C-PB 242 CG11993-PB 1..242 1..242 1290 100 Plus
Mst85C-PA 242 CG11993-PA 1..242 1..242 1290 100 Plus