Clone RE53796 Report

Search the DGRC for RE53796

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:537
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG5969-RA
Protein status:RE53796.pep: gold
Preliminary Size:394
Sequenced Size:948

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5969 2001-12-17 Blastp of sequenced clone
CG5969 2002-01-01 Sim4 clustering to Release 2
CG5969 2008-04-29 Release 5.5 accounting
CG5969 2008-08-15 Release 5.9 accounting
CG5969 2008-12-18 5.12 accounting

Clone Sequence Records

RE53796.complete Sequence

948 bp (948 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071456

> RE53796.complete
GTCATATATTTCTGATAACCGAATGGCAGACCAAAGCAAAACTAGAAATT
GAGAGAAATTGCTGATTTTTCAATTAAGCTGCATTCTATTTAACTGAAAA
GATGTCGACCAAGAACAAGAAAGCCGCCGGAGGCAACGGAGTTGCGCCGA
AACAAACCCGCCAGCAGTCGCACGACTCGCAGGACTACAGCTCCTTCAAG
ACAGTGCTCTTCTACTGCATGCTTATCGTTTTCCTGCCCGTGCTGACCTT
CTTTGTGCTGAAGGGCTTCGTTCTGGACCAGTTCCTCGACATTTCCGAAG
TCAAAGTGAACATAGCATCCGCCGTGGGAGCGGTCGTTGCATTGCACATC
GCCCTGGGACTCTATATATACAGGGCCTACTTTGGGGCACCCGGTTCCAA
GGGCTCCAAAACGGACTAATCCTCATCTACCCCGGACTGTTACCCTATTT
CCATTAACTTTAAGTCGGTAGAGCACTCTTGTACATACATACATGCTACA
TATATAGATACAATTGTTTACATGCCAGCGAGGGAGGAGAAAGTCGCCTG
TAAACCGTGTGTAATCGCTTTTCATTGCATAAGTTTCGATAACAGCGTGG
AAAACGTGTTGTGTTGTGTAGTGTTCTGTGTGCATAATTTGTATTAAAAA
TATACATGCATAAGTGAAATGCGTCTGCTACTCAGAAATTATTCCCTAAT
GGAGGCCGTCAAAAGATTGCTGCCGAGACCGCGCAAAAAAATCTACAATC
TAGGCGCTTGCTTCGAACTGGTGGATATTCCTAAGGTTAACTAAAACATA
CATTTATTTGTACTCTCTGCTTGAAAGGGGAGTTCTGTATAAAGTATACT
GACTTCGGGGATTTTATTATATTGATAAATTAATTTTATGTTTTTGAATT
TTATATTATATGTTTTCTTTTTGATTGAAGCACAAAAAAAAAAAAAAA

RE53796.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5969-RA 933 CG5969-RA 1..933 1..933 4650 99.8 Plus
nc_13793.a 452 nc_13793.a 45..452 529..936 2040 100 Plus
CG5976-RB 1617 CG5976-RB 1..178 608..785 890 100 Plus
nc_13793.a 452 nc_13793.a 1..44 420..463 220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20463044..20463803 174..933 3785 99.9 Plus
chr3L 24539361 chr3L 20462809..20462982 1..174 840 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20474032..20474794 174..936 3815 100 Plus
3L 28110227 3L 20473797..20473970 1..174 855 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20467132..20467894 174..936 3815 100 Plus
3L 28103327 3L 20466897..20467070 1..174 855 99.4 Plus
Blast to na_te.dros performed 2019-03-16 08:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 990..1054 600..662 122 67.7 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 9507..9571 600..662 122 67.7 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1868..1905 776..739 109 76.3 Minus

RE53796.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:27:46 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20462809..20462981 1..173 98 -> Plus
chr3L 20463044..20463730 174..860 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:52 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..318 102..419 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:12 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..318 102..419 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:55:01 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..318 102..419 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:45 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..318 102..419 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:41:25 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..318 102..419 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:27 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..933 1..933 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:12 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..933 1..933 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:55:01 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 15..947 1..933 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:45 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 1..933 1..933 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:41:25 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
CG5969-RA 15..947 1..933 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:46 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20473797..20473969 1..173 99 -> Plus
3L 20474032..20474791 174..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:46 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20473797..20473969 1..173 99 -> Plus
3L 20474032..20474791 174..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:46 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20473797..20473969 1..173 99 -> Plus
3L 20474032..20474791 174..933 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:55:01 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20466897..20467069 1..173 99 -> Plus
arm_3L 20467132..20467891 174..933 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:37 Download gff for RE53796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20467132..20467891 174..933 100   Plus
3L 20466897..20467069 1..173 99 -> Plus

RE53796.pep Sequence

Translation from 101 to 418

> RE53796.pep
MSTKNKKAAGGNGVAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTF
FVLKGFVLDQFLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSK
GSKTD*

RE53796.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10347-PA 106 GF10347-PA 1..106 1..105 451 83 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16118-PA 105 GG16118-PA 1..105 1..105 520 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14552-PA 106 GH14552-PA 1..101 1..104 324 67 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5969-PA 105 CG5969-PA 1..105 1..105 531 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13399-PA 105 GI13399-PA 1..105 1..105 335 70.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12791-PA 108 GL12791-PA 1..108 1..105 401 75 Plus
Dper\GL14676-PA 111 GL14676-PA 1..111 1..105 332 63.1 Plus
Dper\GL23044-PA 203 GL23044-PA 117..190 21..94 159 43.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19267-PA 108 GA19267-PA 1..108 1..105 400 75 Plus
Dpse\GA29180-PA 108 GA29180-PA 1..108 1..105 368 69.4 Plus
Dpse\GA24728-PA 108 GA24728-PA 1..108 1..105 368 69.4 Plus
Dpse\GA23670-PA 111 GA23670-PA 1..111 1..105 336 64 Plus
Dpse\GA12554-PA 203 GA12554-PA 117..190 21..94 159 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22297-PA 105 GM22297-PA 1..105 1..105 532 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14890-PA 105 GD14890-PA 1..105 1..105 537 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11524-PA 107 GJ11524-PA 1..107 1..105 344 62.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12294-PA 110 GK12294-PA 1..110 1..105 375 70.9 Plus
Dwil\GK13232-PA 215 GK13232-PA 144..215 35..105 142 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19686-PA 105 GE19686-PA 1..105 1..105 529 97.1 Plus
Dyak\GE19687-PA 120 GE19687-PA 40..120 25..105 408 97.5 Plus

RE53796.hyp Sequence

Translation from 101 to 418

> RE53796.hyp
MSTKNKKAAGGNGVAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTF
FVLKGFVLDQFLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSK
GSKTD*

RE53796.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG5969-PA 105 CG5969-PA 1..105 1..105 531 100 Plus