Clone RE53816 Report

Search the DGRC for RE53816

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:538
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG7429-RA
Protein status:RE53816.pep: gold
Preliminary Size:543
Sequenced Size:662

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7429 2001-12-14 Blastp of sequenced clone
CG7429 2002-01-01 Sim4 clustering to Release 2
CG7429 2003-01-01 Sim4 clustering to Release 3
CG7429 2008-04-29 Release 5.5 accounting
CG7429 2008-08-15 Release 5.9 accounting
CG7429 2008-12-18 5.12 accounting

Clone Sequence Records

RE53816.complete Sequence

662 bp (662 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071457

> RE53816.complete
ACTAAAATAAAAGACGGCTGGTGAAAATAAAATAATGGATGCAACTGCAG
CAATCACCGGCAATGTGGACAAGACCCAGATACCGCCGCTGAACCAGAAA
CGCATCCTGGCCTTCGTTAACCATTTCCTCGTCAGCACCTGCACCTTTCT
AAATGAATTTGCCCTGGGCTGTGAGACGAAGTTCGTGGAGATGGAACGGC
AGCTGCAGAAGACGGAGGCCGCCCTCATCATCCTGGAGGCCAAGCTGGCG
TCTATACCCACCGAGCACCATGTAGCGACTGAGGCTACCGAAGCGCCAGC
GATATCAAACCAGCAACGCAACGAAGAAGCATCCATGGTGGACACCACGG
AACCACCGACCACCGAGAATCCTACGGAGCCGGAACTCCCGCCTGAATCG
GTTGGTGTGCGCGCCTGTGAAGATCAACGTTACAGAAAGTTCTTCAAAAT
GGTGCAAGTGGGTGTGCCCGCACCGGCGGTTAAGCAGAAAATGCAATCCG
AAGGTCTGGAGCCGCGTATTTTAGACACACCCGATCTGATCCTGGCGGAT
GGCCAGCGAGAGTGAGCTGCCTGGCGCAGAGCGTGATCTGATCTTGTGAT
ATAGCACATGTTGCTACACCTTGCAATTAAACATTTTTTAAAGCTCAAAA
AAAAAAAAAAAA

RE53816.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7429-RA 684 CG7429-RA 39..683 1..645 3225 100 Plus
CG7429.a 618 CG7429.a 105..617 133..645 2565 100 Plus
RpL36A-RA 691 RpL36A-RA 584..691 645..538 540 100 Minus
CG7429.a 618 CG7429.a 29..107 1..79 395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8040244..8040693 76..525 2145 98.4 Plus
chr2L 23010047 chr2L 8040754..8040873 526..645 600 100 Plus
chr2L 23010047 chr2L 8040107..8040188 1..79 330 96.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8041249..8041698 76..525 2250 100 Plus
2L 23513712 2L 8041759..8041878 526..645 600 100 Plus
2L 23513712 2L 8041115..8041193 1..79 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8041249..8041698 76..525 2250 100 Plus
2L 23513712 2L 8041759..8041878 526..645 600 100 Plus
2L 23513712 2L 8041115..8041193 1..79 395 100 Plus
Blast to na_te.dros performed 2019-03-16 07:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 4334..4392 186..242 119 69.5 Plus

RE53816.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:43:48 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8040107..8040188 1..79 96 -> Plus
chr2L 8040248..8040693 80..525 98 -> Plus
chr2L 8040754..8040873 526..646 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:22:53 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..531 35..565 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:22 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..531 35..565 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:34:12 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..531 35..565 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:14:58 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..531 35..565 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:01 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..531 35..565 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:51:49 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..645 1..645 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:21 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..645 1..646 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:34:12 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 10..654 1..646 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:01 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 1..645 1..645 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:01 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
CG7429-RA 10..654 1..646 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:48 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8041759..8041878 526..646 99   Plus
2L 8041115..8041193 1..79 100 -> Plus
2L 8041253..8041698 80..525 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:48 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8041759..8041878 526..646 99   Plus
2L 8041115..8041193 1..79 100 -> Plus
2L 8041253..8041698 80..525 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:48 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8041759..8041878 526..646 99   Plus
2L 8041115..8041193 1..79 100 -> Plus
2L 8041253..8041698 80..525 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:34:12 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8041115..8041193 1..79 100 -> Plus
arm_2L 8041253..8041698 80..525 100 -> Plus
arm_2L 8041759..8041878 526..646 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:00 Download gff for RE53816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8041253..8041698 80..525 100 -> Plus
2L 8041759..8041878 526..646 99   Plus
2L 8041115..8041193 1..79 100 -> Plus

RE53816.pep Sequence

Translation from 34 to 564

> RE53816.pep
MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKF
VEMERQLQKTEAALIILEAKLASIPTEHHVATEATEAPAISNQQRNEEAS
MVDTTEPPTTENPTEPELPPESVGVRACEDQRYRKFFKMVQVGVPAPAVK
QKMQSEGLEPRILDTPDLILADGQRE*

RE53816.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14575-PA 116 GF14575-PA 1..113 53..173 374 67.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10509-PA 175 GG10509-PA 1..175 1..176 751 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11612-PA 162 GH11612-PA 1..162 1..176 540 64.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
CCDC53-PA 176 CG7429-PA 1..176 1..176 899 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17916-PA 162 GI17916-PA 1..159 1..173 544 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18739-PA 179 GL18739-PA 1..179 1..176 554 65.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20344-PA 179 GA20344-PA 1..179 1..176 547 65.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16698-PA 176 GM16698-PA 1..176 1..176 781 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23500-PA 176 GD23500-PA 1..176 1..176 782 90.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17688-PA 165 GJ17688-PA 1..165 1..176 570 64.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15316-PA 177 GK15316-PA 1..177 1..176 584 63 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18730-PA 176 GE18730-PA 1..176 1..176 724 84.4 Plus

RE53816.hyp Sequence

Translation from 34 to 564

> RE53816.hyp
MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKF
VEMERQLQKTEAALIILEAKLASIPTEHHVATEATEAPAISNQQRNEEAS
MVDTTEPPTTENPTEPELPPESVGVRACEDQRYRKFFKMVQVGVPAPAVK
QKMQSEGLEPRILDTPDLILADGQRE*

RE53816.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7429-PA 176 CG7429-PA 1..176 1..176 899 100 Plus