BDGP Sequence Production Resources |
Search the DGRC for RE53816
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 538 |
Well: | 16 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG7429-RA |
Protein status: | RE53816.pep: gold |
Preliminary Size: | 543 |
Sequenced Size: | 662 |
Gene | Date | Evidence |
---|---|---|
CG7429 | 2001-12-14 | Blastp of sequenced clone |
CG7429 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7429 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7429 | 2008-04-29 | Release 5.5 accounting |
CG7429 | 2008-08-15 | Release 5.9 accounting |
CG7429 | 2008-12-18 | 5.12 accounting |
662 bp (662 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071457
> RE53816.complete ACTAAAATAAAAGACGGCTGGTGAAAATAAAATAATGGATGCAACTGCAG CAATCACCGGCAATGTGGACAAGACCCAGATACCGCCGCTGAACCAGAAA CGCATCCTGGCCTTCGTTAACCATTTCCTCGTCAGCACCTGCACCTTTCT AAATGAATTTGCCCTGGGCTGTGAGACGAAGTTCGTGGAGATGGAACGGC AGCTGCAGAAGACGGAGGCCGCCCTCATCATCCTGGAGGCCAAGCTGGCG TCTATACCCACCGAGCACCATGTAGCGACTGAGGCTACCGAAGCGCCAGC GATATCAAACCAGCAACGCAACGAAGAAGCATCCATGGTGGACACCACGG AACCACCGACCACCGAGAATCCTACGGAGCCGGAACTCCCGCCTGAATCG GTTGGTGTGCGCGCCTGTGAAGATCAACGTTACAGAAAGTTCTTCAAAAT GGTGCAAGTGGGTGTGCCCGCACCGGCGGTTAAGCAGAAAATGCAATCCG AAGGTCTGGAGCCGCGTATTTTAGACACACCCGATCTGATCCTGGCGGAT GGCCAGCGAGAGTGAGCTGCCTGGCGCAGAGCGTGATCTGATCTTGTGAT ATAGCACATGTTGCTACACCTTGCAATTAAACATTTTTTAAAGCTCAAAA AAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7429-RA | 684 | CG7429-RA | 39..683 | 1..645 | 3225 | 100 | Plus |
CG7429.a | 618 | CG7429.a | 105..617 | 133..645 | 2565 | 100 | Plus |
RpL36A-RA | 691 | RpL36A-RA | 584..691 | 645..538 | 540 | 100 | Minus |
CG7429.a | 618 | CG7429.a | 29..107 | 1..79 | 395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8040244..8040693 | 76..525 | 2145 | 98.4 | Plus |
chr2L | 23010047 | chr2L | 8040754..8040873 | 526..645 | 600 | 100 | Plus |
chr2L | 23010047 | chr2L | 8040107..8040188 | 1..79 | 330 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rt1c | 5443 | Rt1c RT1C 5443bp | 4334..4392 | 186..242 | 119 | 69.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8040107..8040188 | 1..79 | 96 | -> | Plus |
chr2L | 8040248..8040693 | 80..525 | 98 | -> | Plus |
chr2L | 8040754..8040873 | 526..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..531 | 35..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..531 | 35..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..531 | 35..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..531 | 35..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..531 | 35..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..645 | 1..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..645 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 10..654 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 1..645 | 1..645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7429-RA | 10..654 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8041759..8041878 | 526..646 | 99 | Plus | |
2L | 8041115..8041193 | 1..79 | 100 | -> | Plus |
2L | 8041253..8041698 | 80..525 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8041759..8041878 | 526..646 | 99 | Plus | |
2L | 8041115..8041193 | 1..79 | 100 | -> | Plus |
2L | 8041253..8041698 | 80..525 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8041759..8041878 | 526..646 | 99 | Plus | |
2L | 8041115..8041193 | 1..79 | 100 | -> | Plus |
2L | 8041253..8041698 | 80..525 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8041115..8041193 | 1..79 | 100 | -> | Plus |
arm_2L | 8041253..8041698 | 80..525 | 100 | -> | Plus |
arm_2L | 8041759..8041878 | 526..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8041253..8041698 | 80..525 | 100 | -> | Plus |
2L | 8041759..8041878 | 526..646 | 99 | Plus | |
2L | 8041115..8041193 | 1..79 | 100 | -> | Plus |
Translation from 34 to 564
> RE53816.pep MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKF VEMERQLQKTEAALIILEAKLASIPTEHHVATEATEAPAISNQQRNEEAS MVDTTEPPTTENPTEPELPPESVGVRACEDQRYRKFFKMVQVGVPAPAVK QKMQSEGLEPRILDTPDLILADGQRE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14575-PA | 116 | GF14575-PA | 1..113 | 53..173 | 374 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10509-PA | 175 | GG10509-PA | 1..175 | 1..176 | 751 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11612-PA | 162 | GH11612-PA | 1..162 | 1..176 | 540 | 64.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CCDC53-PA | 176 | CG7429-PA | 1..176 | 1..176 | 899 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17916-PA | 162 | GI17916-PA | 1..159 | 1..173 | 544 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18739-PA | 179 | GL18739-PA | 1..179 | 1..176 | 554 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20344-PA | 179 | GA20344-PA | 1..179 | 1..176 | 547 | 65.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16698-PA | 176 | GM16698-PA | 1..176 | 1..176 | 781 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23500-PA | 176 | GD23500-PA | 1..176 | 1..176 | 782 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17688-PA | 165 | GJ17688-PA | 1..165 | 1..176 | 570 | 64.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15316-PA | 177 | GK15316-PA | 1..177 | 1..176 | 584 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18730-PA | 176 | GE18730-PA | 1..176 | 1..176 | 724 | 84.4 | Plus |
Translation from 34 to 564
> RE53816.hyp MDATAAITGNVDKTQIPPLNQKRILAFVNHFLVSTCTFLNEFALGCETKF VEMERQLQKTEAALIILEAKLASIPTEHHVATEATEAPAISNQQRNEEAS MVDTTEPPTTENPTEPELPPESVGVRACEDQRYRKFFKMVQVGVPAPAVK QKMQSEGLEPRILDTPDLILADGQRE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7429-PA | 176 | CG7429-PA | 1..176 | 1..176 | 899 | 100 | Plus |