Clone RE54375 Report

Search the DGRC for RE54375

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:543
Well:75
Vector:pFlc-1
Associated Gene/TranscriptSNCF-RA
Protein status:RE54375.pep: gold
Preliminary Size:441
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14112 2001-12-14 Blastp of sequenced clone
CG14112 2002-01-01 Sim4 clustering to Release 2
CG14112 2003-01-01 Sim4 clustering to Release 3
SNCF 2008-04-29 Release 5.5 accounting
SNCF 2008-08-15 Release 5.9 accounting
SNCF 2008-12-18 5.12 accounting

Clone Sequence Records

RE54375.complete Sequence

622 bp (622 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071463

> RE54375.complete
ATCATTCACTCCTGAGACTTACAACCCGCAACACACCATGATTGACCAGC
ACAAGCGCAGCCACAAATCAGAGAAATCCAGTCGCAAGTCGGGAAAGAAA
CATTCCGACAAACCACACAAGGTGAAGACCCACGATCCGCTCAAGAAACA
AAAGAAGCGGGCTCTAAAGAAGCTCCGCCGCAAGTCCGCCACCGTGAATT
TCCCGTACCAACTCTTCTTGTACCGCCAAGAACTAAGGCGGGCCAGCGCC
GACTTTTCCTATCTCCGGCTGTCCAAGGCCAAGATAGTGCTTACCTCCCA
ACTAATCGCCAAGAAGATGGGCAGCTGCAATCCCGATTGCAGCGTGGACG
AGCTTAAGGAACTCAGCCGCGAGGTGCAGTTCCAGAAACGCCTCTGCCAT
CAAGTGGAGCGCCTGCAGCAATTCCGGCAACTGGGACTCACCGAGATGAT
CCTCAACGGCAAGAAGACGACGCTGTAACCTGTGGAATTATAGAGGAAAA
AGTCGGATTGAGCAGGCTGTTAGGCTGGGATGGGGCATTATTATAAGTTA
GTCGCTAGTGTTTAGGTTGTAATATTTTATCAAATAAAATATCACATGGA
AATTGCAAAAAAAAAAAAAAAA

RE54375.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-RA 615 SNCF-RA 1..615 1..615 3060 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13368819..13369424 1..606 2880 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:02:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13378585..13379199 1..615 3060 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13371685..13372299 1..615 3060 99.8 Plus
Blast to na_te.dros performed 2019-03-16 03:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 2765..2820 64..119 109 66.1 Plus

RE54375.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:41:21 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13368819..13369424 1..606 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:18 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 38..478 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:09 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 38..478 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:47:46 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 38..478 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:47 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 38..478 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:04 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 38..478 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:54 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..606 1..606 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:08 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..606 1..606 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:47:46 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 3..608 1..606 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:47 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..606 1..606 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:04 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 3..608 1..606 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:21 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13378585..13379190 1..606 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:21 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13378585..13379190 1..606 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:21 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13378585..13379190 1..606 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:47:46 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13371685..13372290 1..606 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:54 Download gff for RE54375.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13371685..13372290 1..606 100   Plus

RE54375.hyp Sequence

Translation from 0 to 477

> RE54375.hyp
SFTPETYNPQHTMIDQHKRSHKSEKSSRKSGKKHSDKPHKVKTHDPLKKQ
KKRALKKLRRKSATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQ
LIAKKMGSCNPDCSVDELKELSREVQFQKRLCHQVERLQQFRQLGLTEMI
LNGKKTTL*

RE54375.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-PA 146 CG14112-PA 1..146 13..158 744 100 Plus
CG13711-PA 127 CG13711-PA 31..115 59..146 150 37.5 Plus

RE54375.pep Sequence

Translation from 37 to 477

> RE54375.pep
MIDQHKRSHKSEKSSRKSGKKHSDKPHKVKTHDPLKKQKKRALKKLRRKS
ATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQLIAKKMGSCNPD
CSVDELKELSREVQFQKRLCHQVERLQQFRQLGLTEMILNGKKTTL*

RE54375.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24040-PA 348 GF24040-PA 2..115 8..126 336 72.3 Plus
Dana\GF25089-PA 124 GF25089-PA 35..112 54..134 159 42 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15636-PA 146 GG15636-PA 1..146 1..146 654 93.8 Plus
Dere\GG15245-PA 126 GG15245-PA 34..114 51..134 170 42.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17159-PA 140 GH17159-PA 44..140 50..146 352 66 Plus
Dgri\GH15695-PA 111 GH15695-PA 22..99 54..134 150 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-PA 146 CG14112-PA 1..146 1..146 744 100 Plus
CG13711-PA 127 CG13711-PA 31..115 47..134 150 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11774-PA 140 GI11774-PA 1..140 2..146 383 55.9 Plus
Dmoj\GI12748-PA 116 GI12748-PA 30..104 57..134 149 41 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15710-PA 99 GL15710-PA 19..99 66..146 309 72.8 Plus
Dper\GL17913-PA 103 GL17913-PA 13..79 57..126 132 44.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29255-PA 138 GA29255-PA 1..138 1..146 383 60.3 Plus
Dpse\GA12768-PA 132 GA12768-PA 9..132 20..146 376 65.4 Plus
Dpse\GA12478-PA 100 GA12478-PA 13..79 57..126 132 44.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25414-PA 146 GM25414-PA 1..146 1..146 655 94.5 Plus
Dsec\GM14678-PA 126 GM14678-PA 33..114 50..134 162 41.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14444-PA 146 GD14444-PA 1..146 1..146 658 95.2 Plus
Dsim\GD22002-PA 53 GD22002-PA 1..53 94..146 277 98.1 Plus
Dsim\GD13861-PA 146 GD13861-PA 33..114 50..134 163 41.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13476-PA 139 GJ13476-PA 30..139 37..146 395 68.2 Plus
Dvir\GJ15516-PA 115 GJ15516-PA 29..103 57..134 145 39.7 Plus
Dvir\GJ15515-PA 90 GJ15515-PA 13..81 57..128 138 43.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17439-PA 145 GK17439-PA 51..145 52..146 376 72.6 Plus
Dwil\GK16598-PA 121 GK16598-PA 30..109 55..134 138 37.3 Plus
Dwil\GK16597-PA 97 GK16597-PA 14..82 57..128 135 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21964-PA 146 GE21964-PA 1..146 1..146 647 93.8 Plus
Dyak\GE21467-PA 120 GE21467-PA 28..108 51..134 168 42.9 Plus