BDGP Sequence Production Resources |
Search the DGRC for RE54375
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 543 |
Well: | 75 |
Vector: | pFlc-1 |
Associated Gene/Transcript | SNCF-RA |
Protein status: | RE54375.pep: gold |
Preliminary Size: | 441 |
Sequenced Size: | 622 |
Gene | Date | Evidence |
---|---|---|
CG14112 | 2001-12-14 | Blastp of sequenced clone |
CG14112 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14112 | 2003-01-01 | Sim4 clustering to Release 3 |
SNCF | 2008-04-29 | Release 5.5 accounting |
SNCF | 2008-08-15 | Release 5.9 accounting |
SNCF | 2008-12-18 | 5.12 accounting |
622 bp (622 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071463
> RE54375.complete ATCATTCACTCCTGAGACTTACAACCCGCAACACACCATGATTGACCAGC ACAAGCGCAGCCACAAATCAGAGAAATCCAGTCGCAAGTCGGGAAAGAAA CATTCCGACAAACCACACAAGGTGAAGACCCACGATCCGCTCAAGAAACA AAAGAAGCGGGCTCTAAAGAAGCTCCGCCGCAAGTCCGCCACCGTGAATT TCCCGTACCAACTCTTCTTGTACCGCCAAGAACTAAGGCGGGCCAGCGCC GACTTTTCCTATCTCCGGCTGTCCAAGGCCAAGATAGTGCTTACCTCCCA ACTAATCGCCAAGAAGATGGGCAGCTGCAATCCCGATTGCAGCGTGGACG AGCTTAAGGAACTCAGCCGCGAGGTGCAGTTCCAGAAACGCCTCTGCCAT CAAGTGGAGCGCCTGCAGCAATTCCGGCAACTGGGACTCACCGAGATGAT CCTCAACGGCAAGAAGACGACGCTGTAACCTGTGGAATTATAGAGGAAAA AGTCGGATTGAGCAGGCTGTTAGGCTGGGATGGGGCATTATTATAAGTTA GTCGCTAGTGTTTAGGTTGTAATATTTTATCAAATAAAATATCACATGGA AATTGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SNCF-RA | 615 | SNCF-RA | 1..615 | 1..615 | 3060 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 13368819..13369424 | 1..606 | 2880 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 13378585..13379199 | 1..615 | 3060 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 13371685..13372299 | 1..615 | 3060 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Transpac | 5249 | Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). | 2765..2820 | 64..119 | 109 | 66.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 13368819..13369424 | 1..606 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..441 | 38..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..441 | 38..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..441 | 38..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..441 | 38..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..441 | 38..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..606 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..606 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 3..608 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 1..606 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SNCF-RA | 3..608 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13378585..13379190 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13378585..13379190 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13378585..13379190 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 13371685..13372290 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13371685..13372290 | 1..606 | 100 | Plus |
Translation from 0 to 477
> RE54375.hyp SFTPETYNPQHTMIDQHKRSHKSEKSSRKSGKKHSDKPHKVKTHDPLKKQ KKRALKKLRRKSATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQ LIAKKMGSCNPDCSVDELKELSREVQFQKRLCHQVERLQQFRQLGLTEMI LNGKKTTL*
Translation from 37 to 477
> RE54375.pep MIDQHKRSHKSEKSSRKSGKKHSDKPHKVKTHDPLKKQKKRALKKLRRKS ATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQLIAKKMGSCNPD CSVDELKELSREVQFQKRLCHQVERLQQFRQLGLTEMILNGKKTTL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24040-PA | 348 | GF24040-PA | 2..115 | 8..126 | 336 | 72.3 | Plus |
Dana\GF25089-PA | 124 | GF25089-PA | 35..112 | 54..134 | 159 | 42 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15636-PA | 146 | GG15636-PA | 1..146 | 1..146 | 654 | 93.8 | Plus |
Dere\GG15245-PA | 126 | GG15245-PA | 34..114 | 51..134 | 170 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17159-PA | 140 | GH17159-PA | 44..140 | 50..146 | 352 | 66 | Plus |
Dgri\GH15695-PA | 111 | GH15695-PA | 22..99 | 54..134 | 150 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SNCF-PA | 146 | CG14112-PA | 1..146 | 1..146 | 744 | 100 | Plus |
CG13711-PA | 127 | CG13711-PA | 31..115 | 47..134 | 150 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11774-PA | 140 | GI11774-PA | 1..140 | 2..146 | 383 | 55.9 | Plus |
Dmoj\GI12748-PA | 116 | GI12748-PA | 30..104 | 57..134 | 149 | 41 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15710-PA | 99 | GL15710-PA | 19..99 | 66..146 | 309 | 72.8 | Plus |
Dper\GL17913-PA | 103 | GL17913-PA | 13..79 | 57..126 | 132 | 44.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA29255-PA | 138 | GA29255-PA | 1..138 | 1..146 | 383 | 60.3 | Plus |
Dpse\GA12768-PA | 132 | GA12768-PA | 9..132 | 20..146 | 376 | 65.4 | Plus |
Dpse\GA12478-PA | 100 | GA12478-PA | 13..79 | 57..126 | 132 | 44.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25414-PA | 146 | GM25414-PA | 1..146 | 1..146 | 655 | 94.5 | Plus |
Dsec\GM14678-PA | 126 | GM14678-PA | 33..114 | 50..134 | 162 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14444-PA | 146 | GD14444-PA | 1..146 | 1..146 | 658 | 95.2 | Plus |
Dsim\GD22002-PA | 53 | GD22002-PA | 1..53 | 94..146 | 277 | 98.1 | Plus |
Dsim\GD13861-PA | 146 | GD13861-PA | 33..114 | 50..134 | 163 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13476-PA | 139 | GJ13476-PA | 30..139 | 37..146 | 395 | 68.2 | Plus |
Dvir\GJ15516-PA | 115 | GJ15516-PA | 29..103 | 57..134 | 145 | 39.7 | Plus |
Dvir\GJ15515-PA | 90 | GJ15515-PA | 13..81 | 57..128 | 138 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17439-PA | 145 | GK17439-PA | 51..145 | 52..146 | 376 | 72.6 | Plus |
Dwil\GK16598-PA | 121 | GK16598-PA | 30..109 | 55..134 | 138 | 37.3 | Plus |
Dwil\GK16597-PA | 97 | GK16597-PA | 14..82 | 57..128 | 135 | 44.4 | Plus |