BDGP Sequence Production Resources |
Search the DGRC for RE54409
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 544 |
Well: | 9 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS10-RA |
Protein status: | RE54409.pep: gold |
Preliminary Size: | 516 |
Sequenced Size: | 734 |
Gene | Date | Evidence |
---|---|---|
CG4247 | 2001-12-14 | Blastp of sequenced clone |
CG4247 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4247 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpS10 | 2008-04-29 | Release 5.5 accounting |
mRpS10 | 2008-08-15 | Release 5.9 accounting |
CG34316 | 2008-08-15 | Release 5.9 accounting |
mRpS10 | 2008-12-18 | 5.12 accounting |
CG34316 | 2008-12-18 | 5.12 accounting |
734 bp (734 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071464
> RE54409.complete TGGTTATAAGCAGTATTGCGGCTGCCGCACTTGCATAATTCTAGGTGTAA ATACAGTTTTTAATATGTTACAGGCTATAAAGACGCTCCGCTGGACACAG CCAATGCGGGCTCTGTCCACGGTAAACACCAGTTCCGGCGTACAAGGCAA TCTTTCACCTGCGGCACCTGCTCCGGAACCGGATAAACTCTACAGCAAGC TGGAGATTGAGCTGCGGGGTATTGATCCGGCAGTTCTGAAGAGCTACACC TGGTTTGCTACTACTGCTGCCGAGCATTTGGGCATTGAAAAGGGAAAATG TTGGTCACCTCGCAAGGCGCACCACGAGCGGATGACGCTCCTGAAGTCGG TGCATATCTACAAGAAACATCGCGTACAGTACGAGGTGCGAACCCACTTC CGCTATATGAACTTCCACAAGTTGACGGGCTCCACGCTAGATACATTTCT AGAGTATATTGAACGTAATCTGCCCGAGGGCGTAGCGCTGCAGGCTTCCA GGACTGAGCTGCAGGAGATCCCAGAGCACTTGCGCCAGCCGCCGGAGCAA GTTTAGCCGAAGCCAATACTACAGTAGACCTTAGTTATTAAAAGTTCAGT ATGAGCTTAGATTGCACCAGCAATCCGCACGGTAATCGGCCGTACTCGGG CCCCGTCCGCGATTAGCAAAGATAAGTTTTTGGCAGAATATTGAAATAAA AGTCGTATCTTGACACACACAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS10-RA | 732 | mRpS10-RA | 15..732 | 3..720 | 3590 | 100 | Plus |
CG34316-RB | 1707 | CG34316-RB | 15..732 | 3..720 | 3590 | 100 | Plus |
mRpS10-RD | 746 | mRpS10-RD | 97..746 | 71..720 | 3250 | 100 | Plus |
mRpS10-RD | 746 | mRpS10-RD | 15..85 | 3..73 | 355 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 11054726..11055146 | 300..720 | 2105 | 100 | Plus |
chr3R | 27901430 | chr3R | 11054428..11054657 | 71..300 | 1150 | 100 | Plus |
chr3R | 27901430 | chr3R | 11054300..11054371 | 3..74 | 360 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 14970927..14971347 | 300..720 | 2105 | 100 | Plus |
3R | 31820162 | 3R | 14970629..14970858 | 71..300 | 1150 | 100 | Plus |
3R | 31820162 | 3R | 14970501..14970572 | 3..74 | 360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11054297..11054370 | 1..73 | 97 | -> | Plus |
chr3R | 11054431..11054657 | 74..300 | 100 | -> | Plus |
chr3R | 11054727..11055146 | 301..720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RC | 1..492 | 65..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 1..492 | 65..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 1..492 | 65..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RC | 1..492 | 65..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 1..492 | 65..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 2..721 | 2..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 12..732 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 3..723 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 2..721 | 2..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RA | 3..723 | 1..720 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15229667..15229740 | 1..73 | 97 | -> | Plus |
3R | 15229801..15230027 | 74..300 | 100 | -> | Plus |
3R | 15230097..15230516 | 301..720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15229667..15229740 | 1..73 | 97 | -> | Plus |
3R | 15229801..15230027 | 74..300 | 100 | -> | Plus |
3R | 15230097..15230516 | 301..720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15229667..15229740 | 1..73 | 97 | -> | Plus |
3R | 15229801..15230027 | 74..300 | 100 | -> | Plus |
3R | 15230097..15230516 | 301..720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11055389..11055462 | 1..73 | 97 | -> | Plus |
arm_3R | 11055523..11055749 | 74..300 | 100 | -> | Plus |
arm_3R | 11055819..11056238 | 301..720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14970632..14970858 | 74..300 | 100 | -> | Plus |
3R | 14970928..14971347 | 301..720 | 100 | Plus | |
3R | 14970498..14970571 | 1..73 | 97 | -> | Plus |
Translation from 2 to 555
> RE54409.hyp RYKQYCGCRTCIILGVNTVFNMLQAIKTLRWTQPMRALSTVNTSSGVQGN LSPAAPAPEPDKLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKC WSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFL EYIERNLPEGVALQASRTELQEIPEHLRQPPEQV*
Translation from 64 to 555
> RE54409.pep MLQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPDKLYSKLEIEL RGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYK KHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLPEGVALQASRTELQ EIPEHLRQPPEQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24771-PA | 164 | GF24771-PA | 1..164 | 1..163 | 753 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16898-PA | 163 | GG16898-PA | 1..163 | 1..163 | 823 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18846-PA | 160 | GH18846-PA | 1..160 | 1..163 | 702 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS10-PA | 163 | CG4247-PA | 1..163 | 1..163 | 858 | 100 | Plus |
mRpS10-PB | 173 | CG4247-PB | 13..173 | 3..163 | 849 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22917-PA | 166 | GI22917-PA | 1..166 | 1..163 | 693 | 79.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12532-PA | 162 | GL12532-PA | 1..162 | 1..163 | 756 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18057-PA | 162 | GA18057-PA | 1..162 | 1..163 | 751 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24206-PA | 163 | GM24206-PA | 1..163 | 1..163 | 859 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18996-PA | 163 | GD18996-PA | 1..163 | 1..163 | 859 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23200-PA | 166 | GJ23200-PA | 1..166 | 1..163 | 707 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14488-PA | 157 | GK14488-PA | 1..157 | 1..163 | 672 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24280-PA | 163 | GE24280-PA | 1..163 | 1..163 | 826 | 93.9 | Plus |