Clone RE54409 Report

Search the DGRC for RE54409

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:544
Well:9
Vector:pFlc-1
Associated Gene/TranscriptmRpS10-RA
Protein status:RE54409.pep: gold
Preliminary Size:516
Sequenced Size:734

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4247 2001-12-14 Blastp of sequenced clone
CG4247 2002-01-01 Sim4 clustering to Release 2
CG4247 2003-01-01 Sim4 clustering to Release 3
mRpS10 2008-04-29 Release 5.5 accounting
mRpS10 2008-08-15 Release 5.9 accounting
CG34316 2008-08-15 Release 5.9 accounting
mRpS10 2008-12-18 5.12 accounting
CG34316 2008-12-18 5.12 accounting

Clone Sequence Records

RE54409.complete Sequence

734 bp (734 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071464

> RE54409.complete
TGGTTATAAGCAGTATTGCGGCTGCCGCACTTGCATAATTCTAGGTGTAA
ATACAGTTTTTAATATGTTACAGGCTATAAAGACGCTCCGCTGGACACAG
CCAATGCGGGCTCTGTCCACGGTAAACACCAGTTCCGGCGTACAAGGCAA
TCTTTCACCTGCGGCACCTGCTCCGGAACCGGATAAACTCTACAGCAAGC
TGGAGATTGAGCTGCGGGGTATTGATCCGGCAGTTCTGAAGAGCTACACC
TGGTTTGCTACTACTGCTGCCGAGCATTTGGGCATTGAAAAGGGAAAATG
TTGGTCACCTCGCAAGGCGCACCACGAGCGGATGACGCTCCTGAAGTCGG
TGCATATCTACAAGAAACATCGCGTACAGTACGAGGTGCGAACCCACTTC
CGCTATATGAACTTCCACAAGTTGACGGGCTCCACGCTAGATACATTTCT
AGAGTATATTGAACGTAATCTGCCCGAGGGCGTAGCGCTGCAGGCTTCCA
GGACTGAGCTGCAGGAGATCCCAGAGCACTTGCGCCAGCCGCCGGAGCAA
GTTTAGCCGAAGCCAATACTACAGTAGACCTTAGTTATTAAAAGTTCAGT
ATGAGCTTAGATTGCACCAGCAATCCGCACGGTAATCGGCCGTACTCGGG
CCCCGTCCGCGATTAGCAAAGATAAGTTTTTGGCAGAATATTGAAATAAA
AGTCGTATCTTGACACACACAAAAAAAAAAAAAA

RE54409.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS10-RA 732 mRpS10-RA 15..732 3..720 3590 100 Plus
CG34316-RB 1707 CG34316-RB 15..732 3..720 3590 100 Plus
mRpS10-RD 746 mRpS10-RD 97..746 71..720 3250 100 Plus
mRpS10-RD 746 mRpS10-RD 15..85 3..73 355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11054726..11055146 300..720 2105 100 Plus
chr3R 27901430 chr3R 11054428..11054657 71..300 1150 100 Plus
chr3R 27901430 chr3R 11054300..11054371 3..74 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15230096..15230516 300..720 2105 100 Plus
3R 32079331 3R 15229798..15230027 71..300 1150 100 Plus
3R 32079331 3R 15229670..15229741 3..74 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14970927..14971347 300..720 2105 100 Plus
3R 31820162 3R 14970629..14970858 71..300 1150 100 Plus
3R 31820162 3R 14970501..14970572 3..74 360 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:30:00 has no hits.

RE54409.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:31:02 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11054297..11054370 1..73 97 -> Plus
chr3R 11054431..11054657 74..300 100 -> Plus
chr3R 11054727..11055146 301..720 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:20 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RC 1..492 65..556 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:42 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 1..492 65..556 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:55:20 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 1..492 65..556 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:25 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RC 1..492 65..556 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:42:15 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 1..492 65..556 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:18 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 2..721 2..720 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:42 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 12..732 1..720 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:55:20 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 3..723 1..720 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:25 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 2..721 2..720 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:42:15 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RA 3..723 1..720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:31:02 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15229667..15229740 1..73 97 -> Plus
3R 15229801..15230027 74..300 100 -> Plus
3R 15230097..15230516 301..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:31:02 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15229667..15229740 1..73 97 -> Plus
3R 15229801..15230027 74..300 100 -> Plus
3R 15230097..15230516 301..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:31:02 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15229667..15229740 1..73 97 -> Plus
3R 15229801..15230027 74..300 100 -> Plus
3R 15230097..15230516 301..720 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:55:20 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11055389..11055462 1..73 97 -> Plus
arm_3R 11055523..11055749 74..300 100 -> Plus
arm_3R 11055819..11056238 301..720 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:24 Download gff for RE54409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14970632..14970858 74..300 100 -> Plus
3R 14970928..14971347 301..720 100   Plus
3R 14970498..14970571 1..73 97 -> Plus

RE54409.hyp Sequence

Translation from 2 to 555

> RE54409.hyp
RYKQYCGCRTCIILGVNTVFNMLQAIKTLRWTQPMRALSTVNTSSGVQGN
LSPAAPAPEPDKLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKC
WSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFL
EYIERNLPEGVALQASRTELQEIPEHLRQPPEQV*

RE54409.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS10-PA 163 CG4247-PA 1..163 22..184 858 100 Plus
mRpS10-PB 173 CG4247-PB 13..173 24..184 849 100 Plus

RE54409.pep Sequence

Translation from 64 to 555

> RE54409.pep
MLQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPDKLYSKLEIEL
RGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYK
KHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLPEGVALQASRTELQ
EIPEHLRQPPEQV*

RE54409.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24771-PA 164 GF24771-PA 1..164 1..163 753 85.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16898-PA 163 GG16898-PA 1..163 1..163 823 93.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18846-PA 160 GH18846-PA 1..160 1..163 702 81.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS10-PA 163 CG4247-PA 1..163 1..163 858 100 Plus
mRpS10-PB 173 CG4247-PB 13..173 3..163 849 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22917-PA 166 GI22917-PA 1..166 1..163 693 79.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12532-PA 162 GL12532-PA 1..162 1..163 756 85.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18057-PA 162 GA18057-PA 1..162 1..163 751 84.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24206-PA 163 GM24206-PA 1..163 1..163 859 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18996-PA 163 GD18996-PA 1..163 1..163 859 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23200-PA 166 GJ23200-PA 1..166 1..163 707 82.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14488-PA 157 GK14488-PA 1..157 1..163 672 79.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24280-PA 163 GE24280-PA 1..163 1..163 826 93.9 Plus