Clone RE54483 Report

Search the DGRC for RE54483

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:544
Well:83
Vector:pFlc-1
Associated Gene/TranscriptRpS15Aa-RA
Protein status:RE54483.pep: gold
Preliminary Size:766
Sequenced Size:702

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2033 2001-12-14 Blastp of sequenced clone
CG2033 2002-01-01 Sim4 clustering to Release 2
CG2033 2003-01-01 Sim4 clustering to Release 3
RpS15Aa 2008-04-29 Release 5.5 accounting
RpS15Aa 2008-08-15 Release 5.9 accounting
RpS15Aa 2008-12-18 5.12 accounting

Clone Sequence Records

RE54483.complete Sequence

702 bp (702 high quality bases) assembled on 2001-12-14

GenBank Submission: AY084182

> RE54483.complete
CTTTTTCCTTCCGTTTCCCTTTCTTTTCCCTTTTTCACGTTTGCCGGTCG
TGTAAAACAGTTTTTGCAAACAAATCCAGCCATGGTGCGTATGAACGTAT
TGGCCGATGCCTTGAAGTGCATAAACAACGCCGAGAAGCGTGGCAAGCGG
CAGGTGCTGCTGCGTCCCTGCTCCAAGGTGATCATCAAGTTCCTGACCGT
GATGATGAAGCATGGCTATATCGGCGAATTCGAGATCGTCGACGATCATC
GTTCCGGCAAGATCGTTGTCAACCTGACCGGTAGGCTAAACAAGTGCGGC
GTCATCTCGCCCCGCTTCGATGTGCCCATCAACGACATCGAGAAATGGAC
CAACAATCTGTTGCCCTCGCGTCAGTTTGGTTACGTTGTGCTCACCACCT
CTGGCGGCATCATGGACCACGAGGAGGCTAGGAGAAAACATTTGGGAGGC
AAAATTCTCGGCTTCTTCTTCTAGAGAAACCAAGTTCGCATCGTAGAGAG
TCTGTATGTGCTGCTAAGGAGTTTGATATGTAGATTGACGTTTTATTTCA
CCGACCATGCAACCAACTATGTACTTTGTGCACAGGAAACAAGGGGCGAA
AACGCTGCTACGTTCATTCAGAAAACAAACGACGATGAATGTTCACAAAG
TTACGCGAAATAAAATGATTGATACATAATAATTTTAAAAAAAAAAAAAA
AA

RE54483.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15Aa-RC 1007 RpS15Aa-RC 54..741 1..688 3440 100 Plus
RpS15Aa-RD 1078 RpS15Aa-RD 169..812 45..688 3220 100 Plus
RpS15Aa-RE 1078 RpS15Aa-RE 169..812 45..688 3220 100 Plus
RpS15Aa-RD 1078 RpS15Aa-RD 54..97 1..44 220 100 Plus
RpS15Aa-RE 1078 RpS15Aa-RE 54..97 1..44 220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13226605..13227214 686..77 3050 100 Minus
chr2R 21145070 chr2R 6709288..6709921 24..668 2635 94.5 Plus
chr2L 23010047 chr2L 14745499..14745767 686..417 1060 93.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13335771..13336382 688..77 3060 100 Minus
2R 25286936 2R 10821751..10822384 24..668 2650 94.6 Plus
2L 23513712 2L 14746805..14747075 688..417 1070 93.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13343869..13344480 688..77 3060 100 Minus
2R 25260384 2R 10822950..10823428 24..498 2145 96.8 Plus
2L 23513712 2L 14746805..14747075 688..417 1080 93.7 Minus
2R 25260384 2R 10823433..10823583 518..668 710 98 Plus
X 23527363 X 13345603..13345637 79..45 175 100 Minus
Blast to na_te.dros performed 2019-03-16 12:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 3127..3169 40..82 107 72.1 Plus

RE54483.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:35:30 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13226605..13227211 80..686 100 <- Minus
chrX 13228337..13228371 45..79 100 <- Minus
chrX 13228443..13228486 1..44 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:26 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RD 1..393 82..474 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:58 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RD 1..393 82..474 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:30:35 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RD 1..393 82..474 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:14 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RD 1..393 82..474 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:48:12 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RD 1..393 82..474 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:45:22 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RC 1..686 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:58 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RC 1..686 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:30:35 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RC 1..686 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:14 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RC 1..686 1..686 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:48:12 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15Aa-RC 52..737 1..686 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:30 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
X 13335773..13336379 80..686 100 <- Minus
X 13337505..13337539 45..79 100 <- Minus
X 13337611..13337654 1..44 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:30 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
X 13335773..13336379 80..686 100 <- Minus
X 13337505..13337539 45..79 100 <- Minus
X 13337611..13337654 1..44 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:30 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
X 13335773..13336379 80..686 100 <- Minus
X 13337505..13337539 45..79 100 <- Minus
X 13337611..13337654 1..44 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:30:35 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13229806..13230412 80..686 100 <- Minus
arm_X 13231538..13231572 45..79 100 <- Minus
arm_X 13231644..13231687 1..44 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:50 Download gff for RE54483.complete
Subject Subject Range Query Range Percent Splice Strand
X 13343871..13344477 80..686 100 <- Minus
X 13345603..13345637 45..79 100 <- Minus
X 13345709..13345752 1..44 100   Minus

RE54483.hyp Sequence

Translation from 0 to 473

> RE54483.hyp
LFPSVSLSFPFFTFAGRVKQFLQTNPAMVRMNVLADALKCINNAEKRGKR
QVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNLTGRLNKCG
VISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGG
KILGFFF*

RE54483.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15Aa-PF 130 CG2033-PF 1..130 28..157 681 100 Plus
RpS15Aa-PE 130 CG2033-PE 1..130 28..157 681 100 Plus
RpS15Aa-PD 130 CG2033-PD 1..130 28..157 681 100 Plus
RpS15Aa-PA 130 CG2033-PA 1..130 28..157 681 100 Plus
RpS15Aa-PC 130 CG2033-PC 1..130 28..157 681 100 Plus

RE54483.pep Sequence

Translation from 81 to 473

> RE54483.pep
MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEF
EIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFG
YVVLTTSGGIMDHEEARRKHLGGKILGFFF*

RE54483.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19502-PA 130 GF19502-PA 1..130 1..130 685 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19508-PA 130 GG19508-PA 1..130 1..130 685 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17815-PA 130 GH17815-PA 1..130 1..130 685 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15Aa-PF 130 CG2033-PF 1..130 1..130 681 100 Plus
RpS15Aa-PE 130 CG2033-PE 1..130 1..130 681 100 Plus
RpS15Aa-PD 130 CG2033-PD 1..130 1..130 681 100 Plus
RpS15Aa-PA 130 CG2033-PA 1..130 1..130 681 100 Plus
RpS15Aa-PC 130 CG2033-PC 1..130 1..130 681 100 Plus
RpS15Ab-PA 130 CG12324-PA 1..130 1..130 670 97.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16425-PA 130 GI16425-PA 1..130 1..130 685 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26726-PA 130 GL26726-PA 1..130 1..130 685 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15195-PA 130 GA15195-PA 1..130 1..130 685 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11496-PA 130 GM11496-PA 1..130 1..130 685 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15889-PA 130 GD15889-PA 1..130 1..130 685 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15828-PA 130 GJ15828-PA 1..130 1..130 685 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16027-PA 130 GK16027-PA 1..130 1..130 685 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS15Aa-PA 130 GE16163-PA 1..130 1..130 685 100 Plus