Clone RE54605 Report

Search the DGRC for RE54605

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:546
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG7713-RA
Protein status:RE54605.pep: gold
Preliminary Size:713
Sequenced Size:810

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7713 2001-12-14 Blastp of sequenced clone
CG7713 2002-01-01 Sim4 clustering to Release 2
CG7713 2003-01-01 Sim4 clustering to Release 3
CG7713 2008-04-29 Release 5.5 accounting
CG7713 2008-08-15 Release 5.9 accounting
CG7713 2008-12-18 5.12 accounting

Clone Sequence Records

RE54605.complete Sequence

810 bp (810 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071466

> RE54605.complete
GTTGTTGTTTTTCTAATTAAGCGATTATTATTTAAAAAAAGCAACATGGT
AGTGCTGAGCTCCTGCTGGTCGCCCATAATTTGGTCGGATAATGTCCGGA
CGGGAAGCTATGCCGTGGCCGGCTATACGGCTGCGCTATCCGCCGTAATG
ATCACGCTGATTTCGTATATGCTAGCAGGCGGGGAGTCTGCGCAGCTCTA
TTCCCCGCTCTTTGAGACGGATATACGTTCGTCGATGCCCGTGGCAGGTG
GCTTCTTTATCATCTACTTCCTGCTAATCATCCTGTCTTCCTATTTGGTC
TACTACGGTATTAAGATCAGCACTCGAGGATGGCTGCTACCCTGGCTGGG
TCTAATTGGACTAGCCATTCTCTTCCAGTTTAGCTGGAGCCTTTGGCTTA
TTGGAGGCTACTATATTTATCTGGAGCAAACCTTCTCGGCCCTTTTGAAC
TTCGTTTGGGTAGCCTACAATATCTATTGCTGGCTGGTGGTCTTCTCGCA
GTACCAGATATTCCTGGAGATCCAGAATCCGAACATTGAGCTGCTCATGC
CATGATGGAAGAACCTCCATACAGAAGCTCGAATAATCTATTAGAATACT
TTTTGACTTGACACGCAACAAGAACTCCGTCCATGCGCATTTTTTACAAT
AAGAATTCCATACAATTCCACAGATGCCTACCAAATAGTTTTATATAAAT
TTATATATTTTACACACATTTATACACGATCAATTATACTTATGTGTAAT
TCGAATGCCTTAGTCTTCTAAACGACAATTAAACAAATAGATTCAAAAAA
AAAAAAAAAA

RE54605.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7713-RA 864 CG7713-RA 66..859 1..794 3970 100 Plus
CG7713.a 888 CG7713.a 128..883 39..794 3780 100 Plus
CG7379-RA 2025 CG7379-RA 1941..2025 794..710 425 100 Minus
CG7713.a 888 CG7713.a 32..72 1..41 205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13620351..13620673 472..794 1615 100 Plus
chr3R 27901430 chr3R 13619715..13619995 40..320 1405 100 Plus
chr3R 27901430 chr3R 13620053..13620156 317..420 505 99 Plus
chr3R 27901430 chr3R 13620219..13620269 421..471 255 100 Plus
chr3R 27901430 chr3R 13619453..13619493 1..41 205 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17795995..17796317 472..794 1615 100 Plus
3R 32079331 3R 17795359..17795639 40..320 1405 100 Plus
3R 32079331 3R 17795697..17795800 317..420 520 100 Plus
3R 32079331 3R 17795863..17795913 421..471 255 100 Plus
3R 32079331 3R 17795097..17795137 1..41 205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17536826..17537148 472..794 1615 100 Plus
3R 31820162 3R 17536190..17536470 40..320 1405 100 Plus
3R 31820162 3R 17536528..17536631 317..420 520 100 Plus
3R 31820162 3R 17536694..17536744 421..471 255 100 Plus
3R 31820162 3R 17535928..17535968 1..41 205 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:34:37 has no hits.

RE54605.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:35:34 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13619453..13619493 1..41 100 -> Plus
chr3R 13619717..13619995 42..320 100 -> Plus
chr3R 13620057..13620156 321..420 99 -> Plus
chr3R 13620219..13620269 421..471 100 -> Plus
chr3R 13620351..13620673 472..794 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:31 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 1..510 46..555 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:38 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RB 1..510 46..555 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:31:12 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 1..510 46..555 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:53 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 1..510 46..555 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:48:19 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 1..510 46..555 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:41:59 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 32..825 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:38 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 32..825 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:31:12 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 32..825 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:53 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 32..825 1..794 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:48:19 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
CG7713-RA 23..816 1..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:34 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17795097..17795137 1..41 100 -> Plus
3R 17795361..17795639 42..320 100 -> Plus
3R 17795701..17795800 321..420 100 -> Plus
3R 17795863..17795913 421..471 100 -> Plus
3R 17795995..17796317 472..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:34 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17795097..17795137 1..41 100 -> Plus
3R 17795361..17795639 42..320 100 -> Plus
3R 17795701..17795800 321..420 100 -> Plus
3R 17795863..17795913 421..471 100 -> Plus
3R 17795995..17796317 472..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:35:34 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17795097..17795137 1..41 100 -> Plus
3R 17795361..17795639 42..320 100 -> Plus
3R 17795701..17795800 321..420 100 -> Plus
3R 17795863..17795913 421..471 100 -> Plus
3R 17795995..17796317 472..794 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:31:12 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13620819..13620859 1..41 100 -> Plus
arm_3R 13621083..13621361 42..320 100 -> Plus
arm_3R 13621423..13621522 321..420 100 -> Plus
arm_3R 13621585..13621635 421..471 100 -> Plus
arm_3R 13621717..13622039 472..794 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:12 Download gff for RE54605.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17536532..17536631 321..420 100 -> Plus
3R 17536694..17536744 421..471 100 -> Plus
3R 17536192..17536470 42..320 100 -> Plus
3R 17536826..17537148 472..794 100   Plus
3R 17535928..17535968 1..41 100 -> Plus

RE54605.hyp Sequence

Translation from 0 to 554

> RE54605.hyp
VVVFLIKRLLFKKSNMVVLSSCWSPIIWSDNVRTGSYAVAGYTAALSAVM
ITLISYMLAGGESAQLYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLV
YYGIKISTRGWLLPWLGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLN
FVWVAYNIYCWLVVFSQYQIFLEIQNPNIELLMP*

RE54605.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7713-PB 169 CG7713-PB 1..169 16..184 886 100 Plus
CG7713-PA 169 CG7713-PA 1..169 16..184 886 100 Plus

RE54605.pep Sequence

Translation from 45 to 554

> RE54605.pep
MVVLSSCWSPIIWSDNVRTGSYAVAGYTAALSAVMITLISYMLAGGESAQ
LYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLVYYGIKISTRGWLLPW
LGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLNFVWVAYNIYCWLVVF
SQYQIFLEIQNPNIELLMP*

RE54605.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16853-PA 169 GF16853-PA 1..169 1..169 811 94.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22526-PA 169 GG22526-PA 1..169 1..169 843 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17286-PA 169 GH17286-PA 1..169 1..169 726 88.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
pasi1-PB 169 CG7713-PB 1..169 1..169 886 100 Plus
pasi1-PA 169 CG7713-PA 1..169 1..169 886 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23454-PA 169 GI23454-PA 1..169 1..169 734 92.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12394-PA 169 GL12394-PA 1..169 1..169 805 91.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20536-PA 169 GA20536-PA 1..169 1..169 805 91.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15263-PA 169 GM15263-PA 1..169 1..169 837 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19187-PA 169 GD19187-PA 1..169 1..169 837 98.2 Plus
Dsim\GD14675-PA 146 GD14675-PA 106..146 129..169 222 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23952-PA 169 GJ23952-PA 1..169 1..169 790 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24979-PA 169 GK24979-PA 1..169 1..169 787 91.7 Plus
Dwil\GK22662-PA 169 GK22662-PA 1..169 1..169 787 91.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25499-PA 169 GE25499-PA 1..169 1..169 839 98.8 Plus