BDGP Sequence Production Resources |
Search the DGRC for RE54605
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 546 |
Well: | 5 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG7713-RA |
Protein status: | RE54605.pep: gold |
Preliminary Size: | 713 |
Sequenced Size: | 810 |
Gene | Date | Evidence |
---|---|---|
CG7713 | 2001-12-14 | Blastp of sequenced clone |
CG7713 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7713 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7713 | 2008-04-29 | Release 5.5 accounting |
CG7713 | 2008-08-15 | Release 5.9 accounting |
CG7713 | 2008-12-18 | 5.12 accounting |
810 bp (810 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071466
> RE54605.complete GTTGTTGTTTTTCTAATTAAGCGATTATTATTTAAAAAAAGCAACATGGT AGTGCTGAGCTCCTGCTGGTCGCCCATAATTTGGTCGGATAATGTCCGGA CGGGAAGCTATGCCGTGGCCGGCTATACGGCTGCGCTATCCGCCGTAATG ATCACGCTGATTTCGTATATGCTAGCAGGCGGGGAGTCTGCGCAGCTCTA TTCCCCGCTCTTTGAGACGGATATACGTTCGTCGATGCCCGTGGCAGGTG GCTTCTTTATCATCTACTTCCTGCTAATCATCCTGTCTTCCTATTTGGTC TACTACGGTATTAAGATCAGCACTCGAGGATGGCTGCTACCCTGGCTGGG TCTAATTGGACTAGCCATTCTCTTCCAGTTTAGCTGGAGCCTTTGGCTTA TTGGAGGCTACTATATTTATCTGGAGCAAACCTTCTCGGCCCTTTTGAAC TTCGTTTGGGTAGCCTACAATATCTATTGCTGGCTGGTGGTCTTCTCGCA GTACCAGATATTCCTGGAGATCCAGAATCCGAACATTGAGCTGCTCATGC CATGATGGAAGAACCTCCATACAGAAGCTCGAATAATCTATTAGAATACT TTTTGACTTGACACGCAACAAGAACTCCGTCCATGCGCATTTTTTACAAT AAGAATTCCATACAATTCCACAGATGCCTACCAAATAGTTTTATATAAAT TTATATATTTTACACACATTTATACACGATCAATTATACTTATGTGTAAT TCGAATGCCTTAGTCTTCTAAACGACAATTAAACAAATAGATTCAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7713-RA | 864 | CG7713-RA | 66..859 | 1..794 | 3970 | 100 | Plus |
CG7713.a | 888 | CG7713.a | 128..883 | 39..794 | 3780 | 100 | Plus |
CG7379-RA | 2025 | CG7379-RA | 1941..2025 | 794..710 | 425 | 100 | Minus |
CG7713.a | 888 | CG7713.a | 32..72 | 1..41 | 205 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 13620351..13620673 | 472..794 | 1615 | 100 | Plus |
chr3R | 27901430 | chr3R | 13619715..13619995 | 40..320 | 1405 | 100 | Plus |
chr3R | 27901430 | chr3R | 13620053..13620156 | 317..420 | 505 | 99 | Plus |
chr3R | 27901430 | chr3R | 13620219..13620269 | 421..471 | 255 | 100 | Plus |
chr3R | 27901430 | chr3R | 13619453..13619493 | 1..41 | 205 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 17795995..17796317 | 472..794 | 1615 | 100 | Plus |
3R | 32079331 | 3R | 17795359..17795639 | 40..320 | 1405 | 100 | Plus |
3R | 32079331 | 3R | 17795697..17795800 | 317..420 | 520 | 100 | Plus |
3R | 32079331 | 3R | 17795863..17795913 | 421..471 | 255 | 100 | Plus |
3R | 32079331 | 3R | 17795097..17795137 | 1..41 | 205 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 17536826..17537148 | 472..794 | 1615 | 100 | Plus |
3R | 31820162 | 3R | 17536190..17536470 | 40..320 | 1405 | 100 | Plus |
3R | 31820162 | 3R | 17536528..17536631 | 317..420 | 520 | 100 | Plus |
3R | 31820162 | 3R | 17536694..17536744 | 421..471 | 255 | 100 | Plus |
3R | 31820162 | 3R | 17535928..17535968 | 1..41 | 205 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 13619453..13619493 | 1..41 | 100 | -> | Plus |
chr3R | 13619717..13619995 | 42..320 | 100 | -> | Plus |
chr3R | 13620057..13620156 | 321..420 | 99 | -> | Plus |
chr3R | 13620219..13620269 | 421..471 | 100 | -> | Plus |
chr3R | 13620351..13620673 | 472..794 | 92 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 1..510 | 46..555 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RB | 1..510 | 46..555 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 1..510 | 46..555 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 1..510 | 46..555 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 1..510 | 46..555 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 32..825 | 1..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 32..825 | 1..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 32..825 | 1..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 32..825 | 1..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7713-RA | 23..816 | 1..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17795097..17795137 | 1..41 | 100 | -> | Plus |
3R | 17795361..17795639 | 42..320 | 100 | -> | Plus |
3R | 17795701..17795800 | 321..420 | 100 | -> | Plus |
3R | 17795863..17795913 | 421..471 | 100 | -> | Plus |
3R | 17795995..17796317 | 472..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17795097..17795137 | 1..41 | 100 | -> | Plus |
3R | 17795361..17795639 | 42..320 | 100 | -> | Plus |
3R | 17795701..17795800 | 321..420 | 100 | -> | Plus |
3R | 17795863..17795913 | 421..471 | 100 | -> | Plus |
3R | 17795995..17796317 | 472..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17795097..17795137 | 1..41 | 100 | -> | Plus |
3R | 17795361..17795639 | 42..320 | 100 | -> | Plus |
3R | 17795701..17795800 | 321..420 | 100 | -> | Plus |
3R | 17795863..17795913 | 421..471 | 100 | -> | Plus |
3R | 17795995..17796317 | 472..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 13620819..13620859 | 1..41 | 100 | -> | Plus |
arm_3R | 13621083..13621361 | 42..320 | 100 | -> | Plus |
arm_3R | 13621423..13621522 | 321..420 | 100 | -> | Plus |
arm_3R | 13621585..13621635 | 421..471 | 100 | -> | Plus |
arm_3R | 13621717..13622039 | 472..794 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17536532..17536631 | 321..420 | 100 | -> | Plus |
3R | 17536694..17536744 | 421..471 | 100 | -> | Plus |
3R | 17536192..17536470 | 42..320 | 100 | -> | Plus |
3R | 17536826..17537148 | 472..794 | 100 | Plus | |
3R | 17535928..17535968 | 1..41 | 100 | -> | Plus |
Translation from 0 to 554
> RE54605.hyp VVVFLIKRLLFKKSNMVVLSSCWSPIIWSDNVRTGSYAVAGYTAALSAVM ITLISYMLAGGESAQLYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLV YYGIKISTRGWLLPWLGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLN FVWVAYNIYCWLVVFSQYQIFLEIQNPNIELLMP*
Translation from 45 to 554
> RE54605.pep MVVLSSCWSPIIWSDNVRTGSYAVAGYTAALSAVMITLISYMLAGGESAQ LYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLVYYGIKISTRGWLLPW LGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLNFVWVAYNIYCWLVVF SQYQIFLEIQNPNIELLMP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16853-PA | 169 | GF16853-PA | 1..169 | 1..169 | 811 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22526-PA | 169 | GG22526-PA | 1..169 | 1..169 | 843 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17286-PA | 169 | GH17286-PA | 1..169 | 1..169 | 726 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pasi1-PB | 169 | CG7713-PB | 1..169 | 1..169 | 886 | 100 | Plus |
pasi1-PA | 169 | CG7713-PA | 1..169 | 1..169 | 886 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23454-PA | 169 | GI23454-PA | 1..169 | 1..169 | 734 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12394-PA | 169 | GL12394-PA | 1..169 | 1..169 | 805 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20536-PA | 169 | GA20536-PA | 1..169 | 1..169 | 805 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15263-PA | 169 | GM15263-PA | 1..169 | 1..169 | 837 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19187-PA | 169 | GD19187-PA | 1..169 | 1..169 | 837 | 98.2 | Plus |
Dsim\GD14675-PA | 146 | GD14675-PA | 106..146 | 129..169 | 222 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23952-PA | 169 | GJ23952-PA | 1..169 | 1..169 | 790 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24979-PA | 169 | GK24979-PA | 1..169 | 1..169 | 787 | 91.7 | Plus |
Dwil\GK22662-PA | 169 | GK22662-PA | 1..169 | 1..169 | 787 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25499-PA | 169 | GE25499-PA | 1..169 | 1..169 | 839 | 98.8 | Plus |