Clone RE54849 Report

Search the DGRC for RE54849

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:548
Well:49
Vector:pFlc-1
Associated Gene/TranscripteIF-1A-RA
Protein status:RE54849.pep: gold
Preliminary Size:932
Sequenced Size:1158

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8053 2002-01-01 Sim4 clustering to Release 2
CG8053 2002-04-21 Blastp of sequenced clone
CG8053 2003-01-01 Sim4 clustering to Release 3
eIF-1A 2008-04-29 Release 5.5 accounting
eIF-1A 2008-08-15 Release 5.9 accounting
eIF-1A 2008-12-18 5.12 accounting

Clone Sequence Records

RE54849.complete Sequence

1158 bp (1158 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113498

> RE54849.complete
AGTTCGATATACTGGTTCCCCGCGAAACCGTCCACCTCTAGTCCTTTTCA
CTTTAGCGAGGCGAAATTGTCACATTTACATTTGACAAAATTGGTCGCCA
ACAAGCCCGCAGACAGCAACAACATCGAAAGTAGCTGCACAGCAACAACA
GCAAACAGCCAAAATGCCCAAGAATAAAGGAAAAGGAGGCAAGAATCGTC
GTCGTGGTAAGAACGAGAACGAGTTCGAGAAGCGTGAGCTGATCTTCAAG
GAGGACCAACAGGAGTACGCGCAGGTGACCAAGATGCTGGGCAACGGTCG
TCTGGAGGCAATGTGCTTTGATGGCGTCAAACGCCTGTGTCACATTCGGG
GGAAACTTCGCAAGAAGGTGTGGATTAACCAGGGCGACATCATATTGGTG
GGCTTGCGTGACTACCAGGACTCGAAGGCTGATGTGATCCTCAAATACAC
ACCGGACGAGGCCAGGAACCTGAAGACGTACGGCGAGTTCCCCGAGTCGG
TGCGCATCAACGAGACAGTCACATTCGTGGAGGATGGCTTCGACGAGGAC
ATCGAGTTCGGCGATGAGATCAGCTCCGAGGATGACGCCGACTCCGTGGA
CAACATCTGATTAACAAGAAACAAAGTGGCGCCGGGTGGGACGACGACGA
CGGCGGGAGCGTCTGGAACGTCTGTCTCGGCAGCAGCACCAGCAGAAGCG
GAATCAGTTCGAGAATAGTAGGGAATTTAATCAATTGTAAAAAGCAGAAA
GCCGGTAGCCCCGAGTCCTGTTCGAAGTCATAGCCAACATCCAATCTAAT
CCAATCCTAAACATTTATCCGGCATCCACAAAGCGGCGCAGCGGCAGTTA
AATTGCGAAACCAAACCTATAGTATCAGTTCATTTATAGCCATTTTTAAT
GTTCTAATCTACTCTGAAATTGTTTTATTCCGAAAATCCAAATTGAAACG
GTTTGATTTATGGCCGCCTTAAACAACAAATTATTAATTACAAATAGTAG
AACTGTTACGCTGTGCAAGAAATGGAACATTGCGAAACATAAACTAATAA
TATTTGAATTAAAAACGAAAAAACAAAGAAAAACAAACGGATATTAGTTA
TTATTTATCTACCAACAAATCTATCCAACTAAATGAAAAAGTAAAAAAAA
AAAAAAAA

RE54849.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-1A-RA 1331 eIF-1A-RA 106..1263 1..1158 5775 99.9 Plus
eIF-1A.c 1784 eIF-1A.c 106..1263 1..1158 5775 99.9 Plus
eIF-1A.b 1180 eIF-1A.b 115..1180 93..1158 5315 99.9 Plus
eIF-1A.b 1180 eIF-1A.b 1..92 1..92 460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14105986..14106762 366..1142 3885 100 Plus
chr3R 27901430 chr3R 14099161..14099438 93..370 1390 100 Plus
chr3R 27901430 chr3R 14098959..14099051 1..93 465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18281692..18282484 366..1158 3950 99.9 Plus
3R 32079331 3R 18274867..18275144 93..370 1390 100 Plus
3R 32079331 3R 18274665..18274757 1..93 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18022523..18023315 366..1158 3950 99.8 Plus
3R 31820162 3R 18015698..18015975 93..370 1390 100 Plus
3R 31820162 3R 18015496..18015588 1..93 465 100 Plus
Blast to na_te.dros performed 2019-03-16 02:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2383 96..163 141 74.6 Plus
jockey2 3428 jockey2 JOCKEY2 3428bp 3223..3415 1068..874 132 54.8 Minus
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 6149..6315 975..1140 130 55.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1511..1581 86..159 128 67.6 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 6025..6094 75..144 115 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1548..1613 99..164 113 67.2 Plus

RE54849.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:25:38 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14098959..14099050 1..92 100 -> Plus
chr3R 14099161..14099435 93..367 100 -> Plus
chr3R 14105988..14106762 368..1142 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:40 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RB 1..447 164..610 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:31 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RB 1..447 164..610 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:20:12 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..447 164..610 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:52 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RB 1..447 164..610 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:09:40 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..447 164..610 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:16 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:31 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:20:12 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:52 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..1142 1..1142 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:09:40 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-1A-RA 1..1142 1..1142 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:25:38 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18274665..18274756 1..92 100 -> Plus
3R 18274867..18275141 93..367 100 -> Plus
3R 18281694..18282468 368..1142 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:25:38 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18274665..18274756 1..92 100 -> Plus
3R 18274867..18275141 93..367 100 -> Plus
3R 18281694..18282468 368..1142 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:25:38 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18274665..18274756 1..92 100 -> Plus
3R 18274867..18275141 93..367 100 -> Plus
3R 18281694..18282468 368..1142 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:20:12 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14100387..14100478 1..92 100 -> Plus
arm_3R 14100589..14100863 93..367 100 -> Plus
arm_3R 14107416..14108190 368..1142 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:56 Download gff for RE54849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18015698..18015972 93..367 100 -> Plus
3R 18022525..18023299 368..1142 100   Plus
3R 18015496..18015587 1..92 100 -> Plus

RE54849.pep Sequence

Translation from 163 to 609

> RE54849.pep
MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAM
CFDGVKRLCHIRGKLRKKVWINQGDIILVGLRDYQDSKADVILKYTPDEA
RNLKTYGEFPESVRINETVTFVEDGFDEDIEFGDEISSEDDADSVDNI*

RE54849.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23078-PA 148 GF23078-PA 1..148 1..148 772 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22826-PA 148 GG22826-PA 1..148 1..148 772 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22399-PA 148 GH22399-PA 1..148 1..148 772 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
eIF1A-PC 148 CG8053-PC 1..148 1..148 777 100 Plus
eIF1A-PB 148 CG8053-PB 1..148 1..148 777 100 Plus
eIF1A-PA 148 CG8053-PA 1..148 1..148 777 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24484-PA 148 GI24484-PA 1..148 1..148 772 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21704-PA 148 GL21704-PA 1..148 1..148 772 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20792-PA 148 GA20792-PA 1..148 1..148 772 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15296-PA 148 GM15296-PA 1..148 1..148 772 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19223-PA 148 GD19223-PA 1..148 1..148 772 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24550-PA 148 GJ24550-PA 1..148 1..148 772 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22392-PA 148 GK22392-PA 1..148 1..148 772 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\eIF-1A-PA 148 GE25530-PA 1..148 1..148 772 100 Plus

RE54849.hyp Sequence

Translation from 163 to 609

> RE54849.hyp
MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAM
CFDGVKRLCHIRGKLRKKVWINQGDIILVGLRDYQDSKADVILKYTPDEA
RNLKTYGEFPESVRINETVTFVEDGFDEDIEFGDEISSEDDADSVDNI*

RE54849.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-1A-PC 148 CG8053-PC 1..148 1..148 777 100 Plus
eIF-1A-PB 148 CG8053-PB 1..148 1..148 777 100 Plus
eIF-1A-PA 148 CG8053-PA 1..148 1..148 777 100 Plus