BDGP Sequence Production Resources |
Search the DGRC for RE54849
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 548 |
Well: | 49 |
Vector: | pFlc-1 |
Associated Gene/Transcript | eIF-1A-RA |
Protein status: | RE54849.pep: gold |
Preliminary Size: | 932 |
Sequenced Size: | 1158 |
Gene | Date | Evidence |
---|---|---|
CG8053 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8053 | 2002-04-21 | Blastp of sequenced clone |
CG8053 | 2003-01-01 | Sim4 clustering to Release 3 |
eIF-1A | 2008-04-29 | Release 5.5 accounting |
eIF-1A | 2008-08-15 | Release 5.9 accounting |
eIF-1A | 2008-12-18 | 5.12 accounting |
1158 bp (1158 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113498
> RE54849.complete AGTTCGATATACTGGTTCCCCGCGAAACCGTCCACCTCTAGTCCTTTTCA CTTTAGCGAGGCGAAATTGTCACATTTACATTTGACAAAATTGGTCGCCA ACAAGCCCGCAGACAGCAACAACATCGAAAGTAGCTGCACAGCAACAACA GCAAACAGCCAAAATGCCCAAGAATAAAGGAAAAGGAGGCAAGAATCGTC GTCGTGGTAAGAACGAGAACGAGTTCGAGAAGCGTGAGCTGATCTTCAAG GAGGACCAACAGGAGTACGCGCAGGTGACCAAGATGCTGGGCAACGGTCG TCTGGAGGCAATGTGCTTTGATGGCGTCAAACGCCTGTGTCACATTCGGG GGAAACTTCGCAAGAAGGTGTGGATTAACCAGGGCGACATCATATTGGTG GGCTTGCGTGACTACCAGGACTCGAAGGCTGATGTGATCCTCAAATACAC ACCGGACGAGGCCAGGAACCTGAAGACGTACGGCGAGTTCCCCGAGTCGG TGCGCATCAACGAGACAGTCACATTCGTGGAGGATGGCTTCGACGAGGAC ATCGAGTTCGGCGATGAGATCAGCTCCGAGGATGACGCCGACTCCGTGGA CAACATCTGATTAACAAGAAACAAAGTGGCGCCGGGTGGGACGACGACGA CGGCGGGAGCGTCTGGAACGTCTGTCTCGGCAGCAGCACCAGCAGAAGCG GAATCAGTTCGAGAATAGTAGGGAATTTAATCAATTGTAAAAAGCAGAAA GCCGGTAGCCCCGAGTCCTGTTCGAAGTCATAGCCAACATCCAATCTAAT CCAATCCTAAACATTTATCCGGCATCCACAAAGCGGCGCAGCGGCAGTTA AATTGCGAAACCAAACCTATAGTATCAGTTCATTTATAGCCATTTTTAAT GTTCTAATCTACTCTGAAATTGTTTTATTCCGAAAATCCAAATTGAAACG GTTTGATTTATGGCCGCCTTAAACAACAAATTATTAATTACAAATAGTAG AACTGTTACGCTGTGCAAGAAATGGAACATTGCGAAACATAAACTAATAA TATTTGAATTAAAAACGAAAAAACAAAGAAAAACAAACGGATATTAGTTA TTATTTATCTACCAACAAATCTATCCAACTAAATGAAAAAGTAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
eIF-1A-RA | 1331 | eIF-1A-RA | 106..1263 | 1..1158 | 5775 | 99.9 | Plus |
eIF-1A.c | 1784 | eIF-1A.c | 106..1263 | 1..1158 | 5775 | 99.9 | Plus |
eIF-1A.b | 1180 | eIF-1A.b | 115..1180 | 93..1158 | 5315 | 99.9 | Plus |
eIF-1A.b | 1180 | eIF-1A.b | 1..92 | 1..92 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14105986..14106762 | 366..1142 | 3885 | 100 | Plus |
chr3R | 27901430 | chr3R | 14099161..14099438 | 93..370 | 1390 | 100 | Plus |
chr3R | 27901430 | chr3R | 14098959..14099051 | 1..93 | 465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18281692..18282484 | 366..1158 | 3950 | 99.9 | Plus |
3R | 32079331 | 3R | 18274867..18275144 | 93..370 | 1390 | 100 | Plus |
3R | 32079331 | 3R | 18274665..18274757 | 1..93 | 465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18022523..18023315 | 366..1158 | 3950 | 99.8 | Plus |
3R | 31820162 | 3R | 18015698..18015975 | 93..370 | 1390 | 100 | Plus |
3R | 31820162 | 3R | 18015496..18015588 | 1..93 | 465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2316..2383 | 96..163 | 141 | 74.6 | Plus |
jockey2 | 3428 | jockey2 JOCKEY2 3428bp | 3223..3415 | 1068..874 | 132 | 54.8 | Minus |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 6149..6315 | 975..1140 | 130 | 55.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1511..1581 | 86..159 | 128 | 67.6 | Plus |
Dyak\TART | 8444 | Dyak\TART TARTYAK 8444bp | 6025..6094 | 75..144 | 115 | 66.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1548..1613 | 99..164 | 113 | 67.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14098959..14099050 | 1..92 | 100 | -> | Plus |
chr3R | 14099161..14099435 | 93..367 | 100 | -> | Plus |
chr3R | 14105988..14106762 | 368..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RB | 1..447 | 164..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RB | 1..447 | 164..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..447 | 164..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RB | 1..447 | 164..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..447 | 164..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..1142 | 1..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..1142 | 1..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..1142 | 1..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..1142 | 1..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
eIF-1A-RA | 1..1142 | 1..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18274665..18274756 | 1..92 | 100 | -> | Plus |
3R | 18274867..18275141 | 93..367 | 100 | -> | Plus |
3R | 18281694..18282468 | 368..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18274665..18274756 | 1..92 | 100 | -> | Plus |
3R | 18274867..18275141 | 93..367 | 100 | -> | Plus |
3R | 18281694..18282468 | 368..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18274665..18274756 | 1..92 | 100 | -> | Plus |
3R | 18274867..18275141 | 93..367 | 100 | -> | Plus |
3R | 18281694..18282468 | 368..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14100387..14100478 | 1..92 | 100 | -> | Plus |
arm_3R | 14100589..14100863 | 93..367 | 100 | -> | Plus |
arm_3R | 14107416..14108190 | 368..1142 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18015698..18015972 | 93..367 | 100 | -> | Plus |
3R | 18022525..18023299 | 368..1142 | 100 | Plus | |
3R | 18015496..18015587 | 1..92 | 100 | -> | Plus |
Translation from 163 to 609
> RE54849.pep MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAM CFDGVKRLCHIRGKLRKKVWINQGDIILVGLRDYQDSKADVILKYTPDEA RNLKTYGEFPESVRINETVTFVEDGFDEDIEFGDEISSEDDADSVDNI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23078-PA | 148 | GF23078-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22826-PA | 148 | GG22826-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22399-PA | 148 | GH22399-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
eIF1A-PC | 148 | CG8053-PC | 1..148 | 1..148 | 777 | 100 | Plus |
eIF1A-PB | 148 | CG8053-PB | 1..148 | 1..148 | 777 | 100 | Plus |
eIF1A-PA | 148 | CG8053-PA | 1..148 | 1..148 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24484-PA | 148 | GI24484-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21704-PA | 148 | GL21704-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20792-PA | 148 | GA20792-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15296-PA | 148 | GM15296-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19223-PA | 148 | GD19223-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24550-PA | 148 | GJ24550-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22392-PA | 148 | GK22392-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\eIF-1A-PA | 148 | GE25530-PA | 1..148 | 1..148 | 772 | 100 | Plus |
Translation from 163 to 609
> RE54849.hyp MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAM CFDGVKRLCHIRGKLRKKVWINQGDIILVGLRDYQDSKADVILKYTPDEA RNLKTYGEFPESVRINETVTFVEDGFDEDIEFGDEISSEDDADSVDNI*