BDGP Sequence Production Resources |
Search the DGRC for RE55001
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 550 |
Well: | 1 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17680-RA |
Protein status: | RE55001.pep: gold |
Preliminary Size: | 294 |
Sequenced Size: | 705 |
Gene | Date | Evidence |
---|---|---|
CG17680 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17680 | 2002-04-04 | Blastp of sequenced clone |
CG17680 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17680 | 2008-04-29 | Release 5.5 accounting |
CG17680 | 2008-08-15 | Release 5.9 accounting |
CG17680 | 2008-12-18 | 5.12 accounting |
705 bp (705 high quality bases) assembled on 2002-04-04
GenBank Submission: AY095085
> RE55001.complete ACTACTACTGGCTGAATCAGCTGCTTGAATCACAAAATACGCACAAATTG AGACAAAATTTTGTTTTTGAAACGAAATAAGCGATAATTGAAGCCTACCA AGATGATTGTCCCACGCCTGGCACTTCCCATTAGCCTTGCCCTGCAGCGC GTGTCGCGCCGGGTGGCGGAACACCCCCATAACCTAAGGATCCTGCAGCG CCACATGTCCAGCGTGTACTTTCGCAGTGGAGCCATCAAACCCAAGCCCG AGGAGATGCCATTCGGCCTGCTGGCCATCTTCTGTGCCGTCATACCGGGA CTCTTCGTGGGCGCCACCATCAGCAAGAACGTGGCCAACTTTCTGGAGGA GAACGATCTGTTCGTGCCCGCGGATGACGACGACGACGAGGATTAAGCAT CCGGACACTTGACAATCTCCATGTGGGAGTGCCTCCTAGTCGGGATAAAT GTGTTGGCAACGCGGCGTTCTCCCACGCAGAGGAAACCAGCTCACGGCCA TATATTTGTTCATCCATTAGCCTCCTTTTTCTACATACATATATAAGAAT CCGCGCAGCTCTTGCATTTTTTTGTGTATTGTCGTGTATTCTTCAAGTCC CGCTTTGATATTTTCGCTTTCTGAATGTTAACTATGCTCGTTAAATACTT GAATGTACTAGAATTAAATAAAGTTTATTCGACTATGCCAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17680-RA | 698 | CG17680-RA | 11..697 | 1..688 | 3400 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14034450..14035137 | 688..1 | 3350 | 99.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18147298..18147984 | 688..1 | 3390 | 99.9 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18148497..18149183 | 688..1 | 3400 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
hobo | 2959 | hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). | 2241..2403 | 518..686 | 109 | 58.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14034449..14035137 | 1..689 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 1..294 | 103..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 1..294 | 103..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 1..294 | 103..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 1..294 | 103..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 1..294 | 103..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 11..697 | 1..689 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 11..697 | 1..689 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 14..700 | 1..689 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 11..697 | 1..689 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17680-RA | 14..700 | 1..689 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18147297..18147984 | 1..689 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18147297..18147984 | 1..689 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18147297..18147984 | 1..689 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14034802..14035489 | 1..689 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18148496..18149183 | 1..689 | 99 | Minus |
Translation from 102 to 395
> RE55001.pep MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPE EMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12281-PA | 97 | GF12281-PA | 1..90 | 1..90 | 401 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20991-PA | 97 | GG20991-PA | 1..97 | 1..97 | 485 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20849-PA | 95 | GH20849-PA | 1..88 | 1..90 | 329 | 70 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
EMRE-PA | 97 | CG17680-PA | 1..97 | 1..97 | 496 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20953-PA | 98 | GI20953-PA | 1..91 | 1..90 | 302 | 67 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10515-PA | 96 | GL10515-PA | 1..89 | 1..90 | 331 | 71.1 | Plus |
Dper\GL25973-PA | 87 | GL25973-PA | 24..87 | 33..94 | 135 | 39.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14609-PA | 96 | GA14609-PA | 1..89 | 1..90 | 331 | 71.1 | Plus |
Dpse\GA25211-PA | 87 | GA25211-PA | 24..87 | 33..94 | 131 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19925-PA | 97 | GM19925-PA | 1..97 | 1..97 | 502 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25414-PA | 97 | GD25414-PA | 1..97 | 1..97 | 502 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20675-PA | 94 | GJ20675-PA | 1..89 | 1..92 | 320 | 71.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19654-PA | 99 | GK19654-PA | 1..92 | 1..90 | 320 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13934-PA | 97 | GE13934-PA | 1..90 | 1..90 | 444 | 95.6 | Plus |
Translation from 102 to 395
> RE55001.hyp MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPE EMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17680-PA | 97 | CG17680-PA | 1..97 | 1..97 | 496 | 100 | Plus |