Clone RE55001 Report

Search the DGRC for RE55001

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:550
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG17680-RA
Protein status:RE55001.pep: gold
Preliminary Size:294
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17680 2002-01-01 Sim4 clustering to Release 2
CG17680 2002-04-04 Blastp of sequenced clone
CG17680 2003-01-01 Sim4 clustering to Release 3
CG17680 2008-04-29 Release 5.5 accounting
CG17680 2008-08-15 Release 5.9 accounting
CG17680 2008-12-18 5.12 accounting

Clone Sequence Records

RE55001.complete Sequence

705 bp (705 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095085

> RE55001.complete
ACTACTACTGGCTGAATCAGCTGCTTGAATCACAAAATACGCACAAATTG
AGACAAAATTTTGTTTTTGAAACGAAATAAGCGATAATTGAAGCCTACCA
AGATGATTGTCCCACGCCTGGCACTTCCCATTAGCCTTGCCCTGCAGCGC
GTGTCGCGCCGGGTGGCGGAACACCCCCATAACCTAAGGATCCTGCAGCG
CCACATGTCCAGCGTGTACTTTCGCAGTGGAGCCATCAAACCCAAGCCCG
AGGAGATGCCATTCGGCCTGCTGGCCATCTTCTGTGCCGTCATACCGGGA
CTCTTCGTGGGCGCCACCATCAGCAAGAACGTGGCCAACTTTCTGGAGGA
GAACGATCTGTTCGTGCCCGCGGATGACGACGACGACGAGGATTAAGCAT
CCGGACACTTGACAATCTCCATGTGGGAGTGCCTCCTAGTCGGGATAAAT
GTGTTGGCAACGCGGCGTTCTCCCACGCAGAGGAAACCAGCTCACGGCCA
TATATTTGTTCATCCATTAGCCTCCTTTTTCTACATACATATATAAGAAT
CCGCGCAGCTCTTGCATTTTTTTGTGTATTGTCGTGTATTCTTCAAGTCC
CGCTTTGATATTTTCGCTTTCTGAATGTTAACTATGCTCGTTAAATACTT
GAATGTACTAGAATTAAATAAAGTTTATTCGACTATGCCAAAAAAAAAAA
AAAAA

RE55001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17680-RA 698 CG17680-RA 11..697 1..688 3400 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14034450..14035137 688..1 3350 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18147298..18147984 688..1 3390 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18148497..18149183 688..1 3400 99.8 Minus
Blast to na_te.dros performed 2019-03-16 07:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2241..2403 518..686 109 58.4 Plus

RE55001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:49:19 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14034449..14035137 1..689 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:47 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 1..294 103..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:16:51 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 1..294 103..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:00 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 1..294 103..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:05 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 1..294 103..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:05 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 1..294 103..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:40:59 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 11..697 1..689 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:16:51 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 11..697 1..689 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:00 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 14..700 1..689 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:05 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 11..697 1..689 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:05 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
CG17680-RA 14..700 1..689 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:19 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18147297..18147984 1..689 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:19 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18147297..18147984 1..689 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:19 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18147297..18147984 1..689 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:00 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14034802..14035489 1..689 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:39:56 Download gff for RE55001.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18148496..18149183 1..689 99   Minus

RE55001.pep Sequence

Translation from 102 to 395

> RE55001.pep
MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPE
EMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED*

RE55001.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12281-PA 97 GF12281-PA 1..90 1..90 401 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20991-PA 97 GG20991-PA 1..97 1..97 485 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20849-PA 95 GH20849-PA 1..88 1..90 329 70 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
EMRE-PA 97 CG17680-PA 1..97 1..97 496 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20953-PA 98 GI20953-PA 1..91 1..90 302 67 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10515-PA 96 GL10515-PA 1..89 1..90 331 71.1 Plus
Dper\GL25973-PA 87 GL25973-PA 24..87 33..94 135 39.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14609-PA 96 GA14609-PA 1..89 1..90 331 71.1 Plus
Dpse\GA25211-PA 87 GA25211-PA 24..87 33..94 131 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19925-PA 97 GM19925-PA 1..97 1..97 502 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25414-PA 97 GD25414-PA 1..97 1..97 502 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20675-PA 94 GJ20675-PA 1..89 1..92 320 71.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19654-PA 99 GK19654-PA 1..92 1..90 320 67.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13934-PA 97 GE13934-PA 1..90 1..90 444 95.6 Plus

RE55001.hyp Sequence

Translation from 102 to 395

> RE55001.hyp
MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPE
EMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED*

RE55001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17680-PA 97 CG17680-PA 1..97 1..97 496 100 Plus