Clone RE55080 Report

Search the DGRC for RE55080

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:550
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG11753-RA
Protein status:RE55080.pep: gold
Preliminary Size:483
Sequenced Size:709

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11753 2001-12-14 Blastp of sequenced clone
CG11753 2002-01-01 Sim4 clustering to Release 2
CG11753 2003-01-01 Sim4 clustering to Release 3
CG11753 2008-04-29 Release 5.5 accounting
CG11753 2008-08-15 Release 5.9 accounting
CG11753 2008-12-18 5.12 accounting

Clone Sequence Records

RE55080.complete Sequence

709 bp (709 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071479

> RE55080.complete
GATAGTCCTCCAGTGTCACCTCTAATGGTTGAGTCAGTTTGTTATGGCCA
GCTAAAAATTAGAAATTTCGTTCTCTAAACGCTGATTTGGCCACCCGAGG
CAACCATGAAGGGCGGCACCTTTCGCAACACGCAGTGGGATCCCACGCTG
CTGTCCTCACAGATTGTGTCCATGCAGTTCTGCGTGTACTTCACCCTTGG
CCTACTCGTCTTCGTGGCCAACAAGTTGTCCGGGGACAACTATAGTCTGG
ATCACTTGTTCGAATACCATGAGATCCACATCTACGACATGGGTGGCCGC
CTGGTGATCTGCGCATTTGTTTTAAATGCGTTCTTAGCCTCCCTGGCACT
GTGGTGCATTGTGAGAAGAGCCAAGCTCTGTCTGGACTTTAGTTGCACCT
TCCACGTGCTGCATTTGCTGATCTGCTGGTGGTACAACCGCTCCTTTCCC
GCGAACGCATCGTGGTGGCTACTGAATGTCATCACCGGCACAATAATGTG
CATAGGCGGCGAGTTTCTCTGCCTGCAGACCGAGATGAAGGAGATCCCAG
TGGGCTATGCGGCCCTCAATCAAAAGTCGGACGTCTGACTCGAAGCCACC
AACTTGTGATGCCTGCTACCCCCCCAACCAAGCCACCCAAAGCAGCTTCT
GTGTACATGTAATTTATTGTTAAACTAGCGTAAGATTACATAGCAAAAAA
AAAAAAAAA

RE55080.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11753-RA 734 CG11753-RA 1..695 1..695 3475 100 Plus
CG11753.b 804 CG11753.b 111..804 1..694 3470 100 Plus
CG11753.a 801 CG11753.a 111..801 1..694 3400 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4479533..4479836 391..694 1520 100 Plus
chr3R 27901430 chr3R 4479005..4479275 1..271 1355 100 Plus
chr3R 27901430 chr3R 4479345..4479466 271..392 610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8653544..8653848 391..695 1525 100 Plus
3R 32079331 3R 8653016..8653286 1..271 1355 100 Plus
3R 32079331 3R 8653356..8653477 271..392 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8394375..8394679 391..695 1525 100 Plus
3R 31820162 3R 8393847..8394117 1..271 1355 100 Plus
3R 31820162 3R 8394187..8394308 271..392 610 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:21:52 has no hits.

RE55080.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:22:30 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4479005..4479274 1..270 100 -> Plus
chr3R 4479345..4479466 271..392 100 -> Plus
chr3R 4479535..4479836 393..694 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:51 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..483 106..588 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:14 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..483 106..588 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:39 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..483 106..588 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:33 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..483 106..588 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:28:51 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..483 106..588 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:45:44 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..694 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:14 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..694 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:39 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 6..699 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:33 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 1..694 1..694 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:28:51 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11753-RA 6..699 1..694 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:30 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653016..8653285 1..270 100 -> Plus
3R 8653356..8653477 271..392 100 -> Plus
3R 8653546..8653847 393..694 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:30 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653016..8653285 1..270 100 -> Plus
3R 8653356..8653477 271..392 100 -> Plus
3R 8653546..8653847 393..694 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:30 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653016..8653285 1..270 100 -> Plus
3R 8653356..8653477 271..392 100 -> Plus
3R 8653546..8653847 393..694 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:39 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4479078..4479199 271..392 100 -> Plus
arm_3R 4478738..4479007 1..270 100 -> Plus
arm_3R 4479268..4479569 393..694 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:10 Download gff for RE55080.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8393847..8394116 1..270 100 -> Plus
3R 8394187..8394308 271..392 100 -> Plus
3R 8394377..8394678 393..694 100   Plus

RE55080.hyp Sequence

Translation from 105 to 587

> RE55080.hyp
MKGGTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDH
LFEYHEIHIYDMGGRLVICAFVLNAFLASLALWCIVRRAKLCLDFSCTFH
VLHLLICWWYNRSFPANASWWLLNVITGTIMCIGGEFLCLQTEMKEIPVG
YAALNQKSDV*

RE55080.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11753-PA 160 CG11753-PA 1..160 1..160 872 100 Plus
CG11753-PC 159 CG11753-PC 1..159 1..160 855 99.4 Plus
CG11753-PB 159 CG11753-PB 1..159 1..160 855 99.4 Plus

RE55080.pep Sequence

Translation from 105 to 587

> RE55080.pep
MKGGTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDH
LFEYHEIHIYDMGGRLVICAFVLNAFLASLALWCIVRRAKLCLDFSCTFH
VLHLLICWWYNRSFPANASWWLLNVITGTIMCIGGEFLCLQTEMKEIPVG
YAALNQKSDV*

RE55080.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18665-PA 160 GF18665-PA 1..160 1..160 837 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11510-PA 160 GG11510-PA 1..160 1..160 849 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17599-PA 160 GH17599-PA 1..160 1..160 807 91.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG11753-PA 160 CG11753-PA 1..160 1..160 872 100 Plus
CG11753-PC 159 CG11753-PC 1..159 1..160 855 99.4 Plus
CG11753-PB 159 CG11753-PB 1..159 1..160 855 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22531-PA 160 GI22531-PA 1..160 1..160 808 93.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23030-PA 160 GL23030-PA 1..160 1..160 831 95.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11175-PA 160 GA11175-PA 1..160 1..160 825 94.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23746-PA 160 GM23746-PA 1..160 1..160 847 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18557-PA 160 GD18557-PA 1..160 1..160 851 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10134-PA 160 GJ10134-PA 1..160 1..160 812 93.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13214-PA 160 GK13214-PA 1..160 1..160 835 96.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25890-PA 160 GE25890-PA 1..160 1..160 845 98.8 Plus