BDGP Sequence Production Resources |
Search the DGRC for RE55080
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 550 |
Well: | 80 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11753-RA |
Protein status: | RE55080.pep: gold |
Preliminary Size: | 483 |
Sequenced Size: | 709 |
Gene | Date | Evidence |
---|---|---|
CG11753 | 2001-12-14 | Blastp of sequenced clone |
CG11753 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11753 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11753 | 2008-04-29 | Release 5.5 accounting |
CG11753 | 2008-08-15 | Release 5.9 accounting |
CG11753 | 2008-12-18 | 5.12 accounting |
709 bp (709 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071479
> RE55080.complete GATAGTCCTCCAGTGTCACCTCTAATGGTTGAGTCAGTTTGTTATGGCCA GCTAAAAATTAGAAATTTCGTTCTCTAAACGCTGATTTGGCCACCCGAGG CAACCATGAAGGGCGGCACCTTTCGCAACACGCAGTGGGATCCCACGCTG CTGTCCTCACAGATTGTGTCCATGCAGTTCTGCGTGTACTTCACCCTTGG CCTACTCGTCTTCGTGGCCAACAAGTTGTCCGGGGACAACTATAGTCTGG ATCACTTGTTCGAATACCATGAGATCCACATCTACGACATGGGTGGCCGC CTGGTGATCTGCGCATTTGTTTTAAATGCGTTCTTAGCCTCCCTGGCACT GTGGTGCATTGTGAGAAGAGCCAAGCTCTGTCTGGACTTTAGTTGCACCT TCCACGTGCTGCATTTGCTGATCTGCTGGTGGTACAACCGCTCCTTTCCC GCGAACGCATCGTGGTGGCTACTGAATGTCATCACCGGCACAATAATGTG CATAGGCGGCGAGTTTCTCTGCCTGCAGACCGAGATGAAGGAGATCCCAG TGGGCTATGCGGCCCTCAATCAAAAGTCGGACGTCTGACTCGAAGCCACC AACTTGTGATGCCTGCTACCCCCCCAACCAAGCCACCCAAAGCAGCTTCT GTGTACATGTAATTTATTGTTAAACTAGCGTAAGATTACATAGCAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 4479533..4479836 | 391..694 | 1520 | 100 | Plus |
chr3R | 27901430 | chr3R | 4479005..4479275 | 1..271 | 1355 | 100 | Plus |
chr3R | 27901430 | chr3R | 4479345..4479466 | 271..392 | 610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4479005..4479274 | 1..270 | 100 | -> | Plus |
chr3R | 4479345..4479466 | 271..392 | 100 | -> | Plus |
chr3R | 4479535..4479836 | 393..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..483 | 106..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..483 | 106..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..483 | 106..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..483 | 106..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..483 | 106..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..694 | 1..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..694 | 1..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 6..699 | 1..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 1..694 | 1..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11753-RA | 6..699 | 1..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8653016..8653285 | 1..270 | 100 | -> | Plus |
3R | 8653356..8653477 | 271..392 | 100 | -> | Plus |
3R | 8653546..8653847 | 393..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8653016..8653285 | 1..270 | 100 | -> | Plus |
3R | 8653356..8653477 | 271..392 | 100 | -> | Plus |
3R | 8653546..8653847 | 393..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8653016..8653285 | 1..270 | 100 | -> | Plus |
3R | 8653356..8653477 | 271..392 | 100 | -> | Plus |
3R | 8653546..8653847 | 393..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4479078..4479199 | 271..392 | 100 | -> | Plus |
arm_3R | 4478738..4479007 | 1..270 | 100 | -> | Plus |
arm_3R | 4479268..4479569 | 393..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8393847..8394116 | 1..270 | 100 | -> | Plus |
3R | 8394187..8394308 | 271..392 | 100 | -> | Plus |
3R | 8394377..8394678 | 393..694 | 100 | Plus |
Translation from 105 to 587
> RE55080.hyp MKGGTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDH LFEYHEIHIYDMGGRLVICAFVLNAFLASLALWCIVRRAKLCLDFSCTFH VLHLLICWWYNRSFPANASWWLLNVITGTIMCIGGEFLCLQTEMKEIPVG YAALNQKSDV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11753-PA | 160 | CG11753-PA | 1..160 | 1..160 | 872 | 100 | Plus |
CG11753-PC | 159 | CG11753-PC | 1..159 | 1..160 | 855 | 99.4 | Plus |
CG11753-PB | 159 | CG11753-PB | 1..159 | 1..160 | 855 | 99.4 | Plus |
Translation from 105 to 587
> RE55080.pep MKGGTFRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDH LFEYHEIHIYDMGGRLVICAFVLNAFLASLALWCIVRRAKLCLDFSCTFH VLHLLICWWYNRSFPANASWWLLNVITGTIMCIGGEFLCLQTEMKEIPVG YAALNQKSDV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18665-PA | 160 | GF18665-PA | 1..160 | 1..160 | 837 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11510-PA | 160 | GG11510-PA | 1..160 | 1..160 | 849 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17599-PA | 160 | GH17599-PA | 1..160 | 1..160 | 807 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11753-PA | 160 | CG11753-PA | 1..160 | 1..160 | 872 | 100 | Plus |
CG11753-PC | 159 | CG11753-PC | 1..159 | 1..160 | 855 | 99.4 | Plus |
CG11753-PB | 159 | CG11753-PB | 1..159 | 1..160 | 855 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22531-PA | 160 | GI22531-PA | 1..160 | 1..160 | 808 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23030-PA | 160 | GL23030-PA | 1..160 | 1..160 | 831 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11175-PA | 160 | GA11175-PA | 1..160 | 1..160 | 825 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23746-PA | 160 | GM23746-PA | 1..160 | 1..160 | 847 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18557-PA | 160 | GD18557-PA | 1..160 | 1..160 | 851 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10134-PA | 160 | GJ10134-PA | 1..160 | 1..160 | 812 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13214-PA | 160 | GK13214-PA | 1..160 | 1..160 | 835 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25890-PA | 160 | GE25890-PA | 1..160 | 1..160 | 845 | 98.8 | Plus |