Clone RE55111 Report

Search the DGRC for RE55111

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:551
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG9922-RA
Protein status:RE55111.pep: gold
Preliminary Size:375
Sequenced Size:789

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9922 2001-12-14 Blastp of sequenced clone
CG9922 2002-01-01 Sim4 clustering to Release 2
CG9922 2003-01-01 Sim4 clustering to Release 3
CG9922 2008-04-29 Release 5.5 accounting
CG9922 2008-08-15 Release 5.9 accounting
CG9922 2008-12-18 5.12 accounting

Clone Sequence Records

RE55111.complete Sequence

789 bp (789 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071481

> RE55111.complete
AATTAATTTAATACAGCGCTAAGTGCATATTGAAAATACACAATTTCCAA
ATTCGAAATTACATAAAAAACTTCAAAAACTATTACAATAAAAGCCAAGC
AAACACTCATAGATTATTAGTTAAATTATGTCGATTGTGTTATCGCTAGT
AGTCCATCTCTAATCGCACGAGGTGAAGAAATCGCAAAGAATTTCGGAAC
TTTTATTGAATTAAACATAAAAAAAAACAATTGAAAATGACGGAAGCAGC
GGAAATCAACGGCAGAGAAGAAGTGGAGGATGACGAGCAGGATAAAAAGC
AAAAGAAATCCGATGTGAAACGACATGACGACGGCGCCGCAGATTTGGAA
CGTGTGACGGATTATGCCGAGGAAAAGGAGATCTCTGCGGACAATATATC
CAGCGCCGTGGAGCAGTTTGGCAACCAGCGTAACAAGGAGAACGAACTGC
GAGTAGCCAAAGAGAAGGAGCTCCAGAAGGTCCAAGTCAAGAAGGAGGAC
ATTGAACTGATTATGAACGAGCTGCTGGTTAGCAAGGCGCATGCCGAGAA
AGTGCTCCGCGAGCAGAGCGGCGATGTGGTGGCCGCCTTGGAAGCCATCA
TCAGCAATTGAGGTGCTCGTGGAATCCGAAGCAATCCGCCGTCTGTTTCT
TTTATGTAGCGTAACAACACACTGCTTTATTTGTACATTTATAAACTCTA
GCGAAGAAAACAATACAAAACAAAAAGACTTTTAAGCCCACAAATGAGTG
AGAGTGCTTACATCGTCTAAACGAAAAAAAAAAAAAAAA

RE55111.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG9922.b 1047 CG9922.b 234..1008 1..775 3875 100 Plus
CG9922-RA 814 CG9922-RA 1..775 1..775 3875 100 Plus
CG9922.a 502 CG9922.a 70..502 343..775 2165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9860735..9861076 342..1 1710 100 Minus
chr3R 27901430 chr3R 9859929..9860189 773..513 1305 100 Minus
chr3R 27901430 chr3R 9860355..9860462 512..405 540 100 Minus
chr3R 27901430 chr3R 9860531..9860595 405..341 325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14035824..14036165 342..1 1710 100 Minus
3R 32079331 3R 14035016..14035278 775..513 1315 100 Minus
3R 32079331 3R 14035444..14035551 512..405 540 100 Minus
3R 32079331 3R 14035620..14035684 405..341 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13776655..13776996 342..1 1710 100 Minus
3R 31820162 3R 13775847..13776109 775..513 1315 100 Minus
3R 31820162 3R 13776275..13776382 512..405 540 100 Minus
3R 31820162 3R 13776451..13776515 405..341 325 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:46:19 has no hits.

RE55111.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:47:30 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9859929..9860189 513..773 100 <- Minus
chr3R 9860355..9860462 405..512 100 <- Minus
chr3R 9860532..9860593 343..404 100 <- Minus
chr3R 9860735..9861076 1..342 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:53 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..375 237..611 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:26 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..375 237..611 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:14:36 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..375 237..611 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:35 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..375 237..611 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:28 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..375 237..611 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:40 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..773 1..773 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:26 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..773 1..773 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:14:36 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RB 234..1006 1..773 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:35 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RA 1..773 1..773 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:28 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
CG9922-RB 234..1006 1..773 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:30 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14035018..14035278 513..773 100 <- Minus
3R 14035444..14035551 405..512 100 <- Minus
3R 14035621..14035682 343..404 100 <- Minus
3R 14035824..14036165 1..342 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:30 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14035018..14035278 513..773 100 <- Minus
3R 14035444..14035551 405..512 100 <- Minus
3R 14035621..14035682 343..404 100 <- Minus
3R 14035824..14036165 1..342 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:30 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14035018..14035278 513..773 100 <- Minus
3R 14035444..14035551 405..512 100 <- Minus
3R 14035621..14035682 343..404 100 <- Minus
3R 14035824..14036165 1..342 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:14:36 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9860740..9861000 513..773 100 <- Minus
arm_3R 9861166..9861273 405..512 100 <- Minus
arm_3R 9861343..9861404 343..404 100 <- Minus
arm_3R 9861546..9861887 1..342 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:14 Download gff for RE55111.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13775849..13776109 513..773 100 <- Minus
3R 13776275..13776382 405..512 100 <- Minus
3R 13776452..13776513 343..404 100 <- Minus
3R 13776655..13776996 1..342 100   Minus

RE55111.pep Sequence

Translation from 236 to 610

> RE55111.pep
MTEAAEINGREEVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEIS
ADNISSAVEQFGNQRNKENELRVAKEKELQKVQVKKEDIELIMNELLVSK
AHAEKVLREQSGDVVAALEAIISN*

RE55111.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18795-PA 124 GF18795-PA 7..124 6..124 528 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21566-PA 124 GG21566-PA 1..124 1..124 592 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18410-PA 126 GH18410-PA 1..126 1..124 476 81.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG9922-PB 124 CG9922-PB 1..124 1..124 605 100 Plus
CG9922-PA 124 CG9922-PA 1..124 1..124 605 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10786-PA 126 GI10786-PA 9..126 6..124 462 83.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23316-PA 127 GL23316-PA 1..127 1..124 479 83.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22126-PA 127 GA22126-PA 1..127 1..124 488 84.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25892-PA 124 GM25892-PA 1..124 1..124 606 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20462-PA 124 GD20462-PA 1..124 1..124 606 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14384-PA 126 GJ14384-PA 9..126 6..124 474 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22479-PA 129 GK22479-PA 1..126 1..122 454 77 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10068-PA 124 GE10068-PA 1..124 1..124 592 97.6 Plus

RE55111.hyp Sequence

Translation from 236 to 610

> RE55111.hyp
MTEAAEINGREEVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEIS
ADNISSAVEQFGNQRNKENELRVAKEKELQKVQVKKEDIELIMNELLVSK
AHAEKVLREQSGDVVAALEAIISN*

RE55111.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9922-PB 124 CG9922-PB 1..124 1..124 605 100 Plus
CG9922-PA 124 CG9922-PA 1..124 1..124 605 100 Plus