Clone RE55125 Report

Search the DGRC for RE55125

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:551
Well:25
Vector:pFlc-1
Associated Gene/TranscriptCG11077-RA
Protein status:RE55125.pep: gold
Preliminary Size:582
Sequenced Size:701

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11077 2001-12-14 Blastp of sequenced clone
CG11077 2002-01-01 Sim4 clustering to Release 2
CG11077 2003-01-01 Sim4 clustering to Release 3
CG11077 2008-04-29 Release 5.5 accounting
CG11077 2008-08-15 Release 5.9 accounting
CG11077 2008-12-18 5.12 accounting

Clone Sequence Records

RE55125.complete Sequence

701 bp (701 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071482

> RE55125.complete
AACCCTTTAAAACTACACGAACAACAGCAAATCGATTTCTCAGTTGTGTT
TTAATTGCGTATTTAAAACAATTTGGATCGGGCTATGAATGGAACTGATC
TCTGATAAGGATGAAGAGACTTAAAGCGTACCTAAAGGATGGCATCAATG
TGGCGGCGGTAATGTGTCTGGGCGATACTATATCCCAGTTCTTTTTTGAT
AAGAAATCGTTGGACGAATGGGATGCGGGGCGAACCCTCCGTTTCGGCAT
CGTTGGACTGGTGTTCGTTGGCCCAACTTTGCGCCGGTGGTACCATTTTT
TGGAGTCCCGGGTTCCCAAAACCTACTCGCCAATGCGGCGGGGCGTTACC
AAAATGCTGGTCGACCAGACCCTTTTTGCGCCACCCTTTACCATGGCCAT
GTCTTTTTTGGTGCCACTCTCCAACGGAGAGCCCATCGACCGAATCCGGC
AGCGCATTCTTGATAGCTACCTATCTATATTGGTCCGCAACTATATGCTC
TGGCCGGCCGCACAGATGCTAAACTTCAGATTCGTGCCGCTGGGCTACCA
GGTGCTCTACGCCCAGTTCATCGCCCTCGTATGGAACTGCTACCTCTCCA
TGATACTTAATAGCTAGGGCACTAAGTTCCCCGCATAAGTAATACGGTGC
CTGTGTATCAAATTTAACAAATACATTATTATCCTAAAAAAAAAAAAAAA
A

RE55125.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11077-RA 685 CG11077-RA 1..685 1..685 3425 100 Plus
nc_20861.a 422 nc_20861.a 48..422 651..277 1875 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 1049189..1049873 685..1 3410 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1028675..1029359 685..1 3425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 1028675..1029359 685..1 3425 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:37:13 has no hits.

RE55125.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:28 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 1049189..1049873 1..685 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:55 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..507 111..617 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:12 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..507 111..617 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:26:07 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..507 111..617 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:20 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..507 111..617 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:29 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..507 111..617 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:22 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..685 1..685 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:12 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..685 1..685 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:26:07 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 3..687 1..685 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:21 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 1..685 1..685 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:29 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
CG11077-RA 3..687 1..685 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:28 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
4 1028675..1029359 1..685 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:28 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
4 1028675..1029359 1..685 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:28 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
4 1028675..1029359 1..685 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:26:07 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1049301..1049985 1..685 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:59 Download gff for RE55125.complete
Subject Subject Range Query Range Percent Splice Strand
4 1028675..1029359 1..685 100   Minus

RE55125.pep Sequence

Translation from 110 to 616

> RE55125.pep
MKRLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGL
VFVGPTLRRWYHFLESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFL
VPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLY
AQFIALVWNCYLSMILNS*

RE55125.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20925-PA 167 GF20925-PA 3..166 4..167 567 61.6 Plus
Dana\GF24503-PA 236 GF24503-PA 64..219 7..165 176 31.3 Plus
Dana\GF20998-PA 194 GF20998-PA 27..180 8..163 165 28.1 Plus
Dana\GF16076-PA 176 GF16076-PA 11..153 21..165 153 27.6 Plus
Dana\GF19409-PA 254 GF19409-PA 99..243 19..165 153 26.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16424-PA 168 GG16424-PA 1..168 1..168 783 87.5 Plus
Dere\GG11233-PA 193 GG11233-PA 15..170 8..165 192 25.9 Plus
Dere\GG12857-PA 196 GG12857-PA 25..178 8..163 171 26.2 Plus
Dere\GG13873-PA 196 GG13873-PA 29..184 7..165 169 33.5 Plus
Dere\GG17779-PA 245 GG17779-PA 88..232 19..165 150 25 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24679-PA 168 GH24679-PA 3..167 4..168 495 52.7 Plus
Dgri\GH16716-PA 220 GH16716-PA 24..184 2..165 171 32.7 Plus
Dgri\GH22820-PA 193 GH22820-PA 28..170 21..165 154 26.9 Plus
Dgri\GH15047-PA 299 GH15047-PA 79..236 8..163 151 24.8 Plus
Dgri\GH24500-PA 193 GH24500-PA 40..179 21..163 144 27.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11077-PA 168 CG11077-PA 1..168 1..168 880 100 Plus
plh-PB 193 CG2022-PB 15..170 8..165 199 25.9 Plus
CG5906-PA 196 CG5906-PA 33..184 11..165 172 30.6 Plus
CG14777-PF 196 CG14777-PF 33..178 16..163 170 27 Plus
CG14777-PC 196 CG14777-PC 33..178 16..163 170 27 Plus
CG14777-PE 196 CG14777-PE 33..178 16..163 170 27 Plus
CG14777-PD 196 CG14777-PD 33..178 16..163 170 27 Plus
CG14777-PB 196 CG14777-PB 33..178 16..163 170 27 Plus
CG32262-PA 273 CG32262-PA 88..234 17..163 151 24.7 Plus
CG1662-PB 245 CG1662-PB 73..232 3..165 145 24.4 Plus
CG1662-PA 245 CG1662-PA 73..232 3..165 145 24.4 Plus
CG14778-PA 186 CG14778-PA 48..172 37..163 142 26 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21659-PA 167 GI21659-PA 5..167 6..168 464 49.1 Plus
Dmoj\GI10222-PA 193 GI10222-PA 15..170 8..165 198 25.9 Plus
Dmoj\GI16042-PA 189 GI16042-PA 4..157 8..163 151 25 Plus
Dmoj\GI13797-PA 217 GI13797-PA 31..182 11..165 148 29.9 Plus
Dmoj\GI16043-PA 186 GI16043-PA 33..172 21..163 145 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16018-PA 167 GL16018-PA 3..166 4..167 576 59.8 Plus
Dper\GL22208-PA 193 GL22208-PA 15..170 8..165 195 26.6 Plus
Dper\GL14256-PA 204 GL14256-PA 28..181 8..163 173 26.9 Plus
Dper\GL25076-PA 197 GL25076-PA 24..184 2..165 165 27.3 Plus
Dper\GL20996-PA 298 GL20996-PA 99..245 17..163 158 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22817-PA 167 GA22817-PA 3..166 4..167 579 60.4 Plus
Dpse\GA15190-PA 193 GA15190-PA 15..170 8..165 195 26.6 Plus
Dpse\GA13236-PA 204 GA13236-PA 28..181 8..163 171 26.2 Plus
Dpse\GA19218-PA 197 GA19218-PA 24..184 2..165 164 27.3 Plus
Dpse\GA23490-PA 298 GA23490-PA 99..245 17..163 158 26.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13015-PA 168 GM13015-PA 1..168 1..168 840 94.6 Plus
Dsec\GM10665-PA 193 GM10665-PA 15..170 8..165 192 25.9 Plus
Dsec\GM19141-PA 196 GM19141-PA 25..178 8..163 173 26.2 Plus
Dsec\GM24695-PA 196 GM24695-PA 29..184 7..165 169 32.7 Plus
Dsec\GM11631-PA 245 GM11631-PA 88..232 19..165 150 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24363-PA 168 GD24363-PA 1..168 1..168 844 94.6 Plus
Dsim\GD19642-PA 193 GD19642-PA 15..170 8..165 192 25.9 Plus
Dsim\GD17579-PA 196 GD17579-PA 29..184 7..165 169 32.7 Plus
Dsim\GD17122-PA 245 GD17122-PA 88..232 19..165 150 25 Plus
Dsim\GD13317-PA 282 GD13317-PA 92..243 12..163 147 23.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16017-PA 168 GJ16017-PA 3..167 4..168 475 48.5 Plus
Dvir\GJ11665-PA 192 GJ11665-PA 24..182 2..163 192 31.3 Plus
Dvir\GJ11024-PA 193 GJ11024-PA 27..170 20..165 191 26 Plus
Dvir\GJ15554-PA 202 GJ15554-PA 29..182 8..163 174 26.9 Plus
Dvir\GJ15555-PA 186 GJ15555-PA 33..172 21..163 155 29.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18850-PA 168 GK18850-PA 3..166 4..167 536 57.3 Plus
Dwil\GK10054-PA 206 GK10054-PA 25..184 3..165 165 26.3 Plus
Dwil\GK19153-PA 197 GK19153-PA 24..176 7..162 162 29.3 Plus
Dwil\GK10055-PA 181 GK10055-PA 28..167 22..163 160 28.1 Plus
Dwil\GK25287-PA 231 GK25287-PA 75..226 11..165 151 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14493-PA 168 GE14493-PA 1..168 1..168 774 86.9 Plus
Dyak\GE25314-PA 193 GE25314-PA 15..170 8..165 194 25.9 Plus
Dyak\GE11128-PA 193 GE11128-PA 15..170 8..165 193 25.9 Plus
Dyak\GE16688-PA 196 GE16688-PA 20..183 2..168 171 26.3 Plus
Dyak\GE20165-PA 196 GE20165-PA 29..184 7..165 169 33.3 Plus

RE55125.hyp Sequence

Translation from 110 to 616

> RE55125.hyp
MKRLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGL
VFVGPTLRRWYHFLESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFL
VPLSNGEPIDRIRQRILDSYLSILVRNYMLWPAAQMLNFRFVPLGYQVLY
AQFIALVWNCYLSMILNS*

RE55125.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11077-PA 168 CG11077-PA 1..168 1..168 880 100 Plus
CG2022-PB 193 CG2022-PB 15..170 8..165 199 25.9 Plus
CG5906-PA 196 CG5906-PA 33..184 11..165 172 30.6 Plus
CG14777-PF 196 CG14777-PF 33..178 16..163 170 27 Plus
CG14777-PC 196 CG14777-PC 33..178 16..163 170 27 Plus