Clone RE55344 Report

Search the DGRC for RE55344

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:553
Well:44
Vector:pFlc-1
Associated Gene/TranscriptGstO3-RA
Protein status:RE55344.pep: gold
Preliminary Size:776
Sequenced Size:893

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6776 2001-12-14 Blastp of sequenced clone
CG6776 2002-01-01 Sim4 clustering to Release 2
CG6776 2003-01-01 Sim4 clustering to Release 3
CG6776 2008-04-29 Release 5.5 accounting
CG6776 2008-08-15 Release 5.9 accounting
CG6776 2008-12-18 5.12 accounting

Clone Sequence Records

RE55344.complete Sequence

893 bp (893 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071484

> RE55344.complete
AGTTCGCATTTCACCGTCGACATTTCAACAGTTAAGCGAATTTGTTCAGT
TCTGCAATTAAACAAAATGAGTTCTGGTAAACATTTGGCCAAAGGTTCCC
CCAAGCCTGTACTCCCTGACGATGGAGTCCTTCGCCTGTACTCCATGAGG
TTCTGTCCCTACGCTCAGCGGGCTCATCTCGTCCTGAACGCCAAGAATGT
GCCCTATCACAGTGTCTACATCAATCTCACCGAGAAACCAGAGTGGCTGG
TGGAAGTGAGTCCGTTGCTTAAGGTGCCTGCCCTGCAGCTGGTGGCGGAG
AAGGGTGAGCCCTCGCTCATCGAGTCGCTGATTATTGCCGAGTATCTGGA
CGATAAGTACCCGGAGAATCCGTTGCTGCCCAAGGACCCATTGAAGCGGG
CACAGGACAAGATTCTGCTGGAACGTTTCAGCAGCATCACCAGTGCCTTC
ATAAACATCCTTGTGCAGGGCACCGGTCTGGAGGATTACTGGACGGCACT
TGATATCTTTGAGGAGGAGTTGACCAAGCGGGGCACCCCATATTTTGGCG
GCAACAAGCCGGGATTCGTGGACTACATGATCTGGCCCTGGTTCGAACGC
CTCTCTGTAATCGAGTTGAAGTTGCAGAAGGAGTACAACTTCAACGAGAG
TCGTTTCCCGAAGATCACCAAGTGGATTGCCCTCCTGAAGGCGGACTCGG
TGGTGCAGTCCTTCTATGCCACTCCCGAGCAGCACAACGAGTTCTGGCGC
ACCCGCAAGGCCGGCAATGCAAACTACGATCTGCTGGCTTAGATCGGTAC
TGAAAATGAAACTATTATATAACAAAGGAGATTTAATAATGTTCTAAAAA
CAATAAAAACTAAAATATTTTATGTGACAAAAAAAAAAAAAAA

RE55344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG6776-RA 1085 CG6776-RA 150..1034 1..885 4410 99.8 Plus
CG6776.a 846 CG6776.a 48..838 95..885 3940 99.8 Plus
se-RA 910 se-RA 132..304 82..254 280 77.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8511483..8512269 93..878 3855 99.6 Plus
chr3L 24539361 chr3L 8510861..8510956 1..96 480 100 Plus
chr3L 24539361 chr3L 8512673..8512806 121..254 250 79.1 Plus
chr3L 24539361 chr3L 8514679..8514783 596..492 195 79 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8519510..8520302 93..885 3950 99.9 Plus
3L 28110227 3L 8518888..8518983 1..96 480 100 Plus
3L 28110227 3L 8520700..8520833 121..254 250 79.1 Plus
3L 28110227 3L 8522705..8522809 596..492 195 79 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8512610..8513402 93..885 3950 99.8 Plus
3L 28103327 3L 8511988..8512083 1..96 480 100 Plus
3L 28103327 3L 8513800..8513933 121..254 250 79.1 Plus
Blast to na_te.dros performed on 2019-03-15 20:24:05 has no hits.

RE55344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:10 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8510861..8510954 1..94 100 -> Plus
chr3L 8511485..8512269 95..878 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:00 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6776-RA 1..726 67..792 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:28 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6776-RA 1..726 67..792 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:12:08 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
GstO3-RA 1..726 67..792 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:39 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6776-RA 1..726 67..792 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:52 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
GstO3-RA 1..726 67..792 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:20 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6776-RA 1..878 1..878 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:28 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6776-RA 1..878 1..878 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:08 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
GstO3-RA 4..881 1..878 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:39 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6776-RA 1..878 1..878 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:52 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
GstO3-RA 4..881 1..878 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:10 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8518888..8518981 1..94 100 -> Plus
3L 8519512..8520295 95..878 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:10 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8518888..8518981 1..94 100 -> Plus
3L 8519512..8520295 95..878 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:10 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8518888..8518981 1..94 100 -> Plus
3L 8519512..8520295 95..878 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:08 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8511988..8512081 1..94 100 -> Plus
arm_3L 8512612..8513395 95..878 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:11:53 Download gff for RE55344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8512612..8513395 95..878 100   Plus
3L 8511988..8512081 1..94 100 -> Plus

RE55344.hyp Sequence

Translation from 0 to 791

> RE55344.hyp
SSHFTVDISTVKRICSVLQLNKMSSGKHLAKGSPKPVLPDDGVLRLYSMR
FCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAE
KGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAF
INILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFER
LSVIELKLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWR
TRKAGNANYDLLA*

RE55344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
GstO3-PA 241 CG6776-PA 1..241 23..263 1272 100 Plus
se-PA 243 CG6781-PA 1..239 23..262 775 57.1 Plus
GstO1-PA 254 CG6662-PA 1..244 23..262 684 50.8 Plus
GstO2-PB 250 CG6673-PB 6..245 27..261 669 51.7 Plus
GstO2-PA 251 CG6673-PA 6..245 27..261 624 48.3 Plus

RE55344.pep Sequence

Translation from 66 to 791

> RE55344.pep
MSSGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSV
YINLTEKPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPE
NPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIFEE
ELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKI
TKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYDLLA*

RE55344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24330-PA 243 GF24330-PA 1..241 1..241 1009 75.9 Plus
Dana\GF24331-PA 243 GF24331-PA 1..240 1..241 773 56.8 Plus
Dana\GF10159-PA 252 GF10159-PA 1..242 1..240 671 52.9 Plus
Dana\GF10160-PA 250 GF10160-PA 7..245 6..239 669 49.8 Plus
Dana\GF10161-PA 223 GF10161-PA 1..217 27..239 536 46.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14320-PA 241 GG14320-PA 1..241 1..241 1186 90.9 Plus
Dere\GG14321-PA 243 GG14321-PA 1..240 1..241 778 57.3 Plus
Dere\GG15073-PA 254 GG15073-PA 1..244 1..240 693 50 Plus
Dere\GG15074-PA 250 GG15074-PA 6..245 5..239 673 51.7 Plus
Dere\GG15075-PA 248 GG15075-PA 5..242 7..239 630 49.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15264-PA 241 GH15264-PA 1..241 1..241 955 73 Plus
Dgri\GH15265-PA 243 GH15265-PA 1..240 1..241 766 56 Plus
Dgri\GH16193-PA 249 GH16193-PA 6..244 5..239 651 49 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
GstO3-PA 241 CG6776-PA 1..241 1..241 1272 100 Plus
se-PA 243 CG6781-PA 1..239 1..240 775 57.1 Plus
GstO1-PA 254 CG6662-PA 1..244 1..240 684 50.8 Plus
GstO2-PB 250 CG6673-PB 6..245 5..239 669 51.7 Plus
GstO2-PA 251 CG6673-PA 6..245 5..239 624 48.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11973-PA 241 GI11973-PA 1..241 1..241 954 71.8 Plus
Dmoj\GI11974-PA 243 GI11974-PA 1..240 1..241 763 57.3 Plus
Dmoj\GI13342-PA 251 GI13342-PA 1..243 1..239 696 52.7 Plus
Dmoj\GI23597-PA 246 GI23597-PA 36..227 24..212 158 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15503-PA 241 GL15503-PA 1..241 1..241 1032 78.8 Plus
Dper\GL15504-PA 243 GL15504-PA 1..240 1..241 765 56 Plus
Dper\GL15565-PA 253 GL15565-PA 1..243 1..240 675 50.2 Plus
Dper\GL15566-PA 250 GL15566-PA 6..245 5..239 671 51.7 Plus
Dper\GL15567-PA 246 GL15567-PA 5..242 7..239 640 49.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23844-PA 241 GA23844-PA 1..241 1..241 1040 79.7 Plus
Dpse\GA19859-PA 243 GA19859-PA 1..240 1..241 768 56.4 Plus
Dpse\GA19769-PA 250 GA19769-PA 6..245 5..239 676 52.1 Plus
Dpse\GA19760-PA 243 GA19760-PA 1..243 1..240 669 49.8 Plus
Dpse\GA23449-PA 246 GA23449-PA 5..242 7..239 647 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25061-PA 241 GM25061-PA 1..241 1..241 1197 92.9 Plus
Dsec\GM24930-PA 254 GM24930-PA 1..244 1..240 688 51.4 Plus
Dsec\GM24931-PA 250 GM24931-PA 6..245 5..239 669 51.7 Plus
Dsec\GM25062-PA 204 GM25062-PA 1..201 1..241 605 49.8 Plus
Dsec\GM24932-PA 224 GM24932-PA 1..218 27..239 563 47.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14099-PA 241 GD14099-PA 1..241 1..241 1164 91.3 Plus
Dsim\GD14100-PA 243 GD14100-PA 1..240 1..241 772 56.8 Plus
Dsim\GD12978-PA 254 GD12978-PA 1..244 1..240 680 49.2 Plus
Dsim\GD12979-PA 250 GD12979-PA 6..245 5..239 668 51.7 Plus
Dsim\GD12980-PA 212 GD12980-PA 1..206 39..239 517 47.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12198-PA 241 GJ12198-PA 1..241 1..241 1007 76.8 Plus
Dvir\GJ12199-PA 243 GJ12199-PA 1..240 1..241 783 57.7 Plus
Dvir\GJ13170-PA 249 GJ13170-PA 6..244 5..239 691 51.9 Plus
Dvir\GJ13171-PA 222 GJ13171-PA 1..218 27..239 577 48.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20354-PA 238 GK20354-PA 6..236 3..233 902 70.1 Plus
Dwil\GK20355-PA 243 GK20355-PA 1..240 1..241 755 55.2 Plus
Dwil\GK20539-PA 251 GK20539-PA 7..246 5..239 681 52.9 Plus
Dwil\GK20538-PA 259 GK20538-PA 1..249 1..240 653 48.6 Plus
Dwil\GK20540-PA 239 GK20540-PA 1..235 10..239 629 49.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20748-PA 241 GE20748-PA 1..241 1..241 1158 88.8 Plus
Dyak\GE20749-PA 243 GE20749-PA 1..240 1..241 778 57.3 Plus
Dyak\GE21297-PA 250 GE21297-PA 6..245 5..239 667 51.2 Plus
Dyak\GE21296-PA 254 GE21296-PA 1..244 1..240 656 50.2 Plus
Dyak\GE21298-PA 224 GE21298-PA 1..218 27..239 561 47.2 Plus