Clone RE55422 Report

Search the DGRC for RE55422

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:554
Well:22
Vector:pFlc-1
Associated Gene/TranscriptnudC-RA
Protein status:RE55422.pep: gold
Preliminary Size:1047
Sequenced Size:1249

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9710 2001-12-14 Blastp of sequenced clone
CG9710 2002-01-01 Sim4 clustering to Release 2
CG9710 2003-01-01 Sim4 clustering to Release 3
nudC 2008-04-29 Release 5.5 accounting
nudC 2008-08-15 Release 5.9 accounting
nudC 2008-12-18 5.12 accounting

Clone Sequence Records

RE55422.complete Sequence

1249 bp (1249 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071485

> RE55422.complete
GAGGTCACATTATTTCTACATGTGCCGGGTCGGCAGCTAAACTTCAGATA
AAAAAACCAAACGAATCGAAGCGTCCAGAAACAAACGAAATCTAATTCAA
AACCAGTACAAATACTCCAAACCATGGCTGCTGAGGAGGGAAAGTTTGAC
AACATACTGCTGGCCGTGGCCGAGAAGCATCACGGTGGCGTGCCCGAGTT
CCTTGGCACTTTGGCCAGTTTTCTGCGCCGCAAGACCGACTTCTTCACGG
GAGCCAAGCAGACGGAGTGGGAGAAGCTGCTGCTGGATGTCTTCAACAAG
GAGTCCAAGCTGGCCGTAACTGAAAACTACGAAAAGATAAAGGCTCGCGA
AGCTTCCCAGCGCCTAAAGGCGGAGAAGGAGAGAGCCGAAAGGAAGGCCC
GCAAGCAGGAGATTGACGATAATAAAATATGTGATATCACTGACGAAGAG
GCAGCGGCCATTATCAAGGAGGAGGAGACCAAAAAACGCCAGCAGCTGCT
GGATAGCGCTGGTGGAGAGCCATCTGCCTCGAACCGAGATGGCATCTCCA
AGCCCATCGAGAAAGTGGACGATGAATCCGATAAGAGTGAGCTGGGTAAG
CTGATGCCGAATGCAGGCAATGGCTGCACCTTGGAAAACTACACCTGGAC
CCAAACTCTGGAGGAGGTGGAGCTCAAGATTCCGTTCAACTTAACATTCG
GTCTACGCGCCCGTGATCTAGTGATCAGTATTGGTAAGAAGTCGCTGAAG
GTGGGCATCAAAGGTCAAACGCCCATCATCGATGGCGAACTGTGCGGCGA
GGTGAAGACGGAGGAGTCCGTGTGGGTCTTGCAAGACAGCAAAACCGTGA
TGATCACTCTTGATAAGATCAATAAGATGAACTGGTGGAGCCGCCTGGTC
ACAACCGATCCAGAGATCTCGACGCGCAAGATCAATCCAGAGTCTTCCAA
GCTTTCTGATCTGGATGGGGAGACTCGCAGTATGGTGGAGAAGATGATGT
ATGATCAGCGACAGAAGGAGTTGGGTCTTCCCACCAGCGAGGATCGCAAA
AAACAGGACATACTTGAGAAATTTAAGCAACAGCATCCTGAGATGGACTT
CTCCAAGTGTAAATTCAATTAATCTAACATTCTCAACTTAACTTGTAAAC
TTTCGATTTCGCACTCTTGTCACTTTTACACATTTAAATGTAAATCTTTT
TCATTTTCCAACCACACAATAAACTAATGCAAGCAAAAAAAAAAAAAAA

RE55422.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
nudC.a 1461 nudC.a 69..1306 2..1238 6150 99.9 Plus
nudC.b 1913 nudC.b 42..1279 2..1238 6150 99.9 Plus
nudC-RA 1434 nudC-RA 42..1279 2..1238 6150 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16808435..16808834 671..1070 1985 99.8 Plus
chr3L 24539361 chr3L 16798244..16798529 197..482 1430 100 Plus
chr3L 24539361 chr3L 16797974..16798170 2..198 970 99.5 Plus
chr3L 24539361 chr3L 16798719..16798908 483..672 950 100 Plus
chr3L 24539361 chr3L 16808898..16809062 1071..1234 775 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16818905..16819304 671..1070 2000 100 Plus
3L 28110227 3L 16808693..16808978 197..482 1430 100 Plus
3L 28110227 3L 16808423..16808619 2..198 985 100 Plus
3L 28110227 3L 16809168..16809357 483..672 950 100 Plus
3L 28110227 3L 16819368..16819536 1071..1238 795 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16812005..16812404 671..1070 2000 100 Plus
3L 28103327 3L 16801793..16802078 197..482 1430 100 Plus
3L 28103327 3L 16801523..16801719 2..198 985 100 Plus
3L 28103327 3L 16802268..16802457 483..672 950 100 Plus
3L 28103327 3L 16812468..16812636 1071..1238 805 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 23:15:14 has no hits.

RE55422.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:16:05 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16797973..16798170 1..198 98 -> Plus
chr3L 16798246..16798529 199..482 100 -> Plus
chr3L 16798719..16798908 483..672 100 -> Plus
chr3L 16808437..16808834 673..1070 99 -> Plus
chr3L 16808898..16809062 1071..1234 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:33:17 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 1..999 124..1122 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:57 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 1..999 124..1122 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:19:49 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 1..999 124..1122 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:13 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 1..999 124..1122 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:25 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 1..999 124..1122 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:33:16 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 2..1235 2..1234 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:57 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 2..1235 2..1234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:19:49 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 4..1238 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:13 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 2..1235 2..1234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:25 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
nudC-RA 4..1238 1..1234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:05 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16808422..16808619 1..198 99 -> Plus
3L 16808695..16808978 199..482 100 -> Plus
3L 16809168..16809357 483..672 100 -> Plus
3L 16818907..16819304 673..1070 100 -> Plus
3L 16819368..16819532 1071..1234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:05 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16808422..16808619 1..198 99 -> Plus
3L 16808695..16808978 199..482 100 -> Plus
3L 16809168..16809357 483..672 100 -> Plus
3L 16818907..16819304 673..1070 100 -> Plus
3L 16819368..16819532 1071..1234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:05 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16808422..16808619 1..198 99 -> Plus
3L 16808695..16808978 199..482 100 -> Plus
3L 16809168..16809357 483..672 100 -> Plus
3L 16818907..16819304 673..1070 100 -> Plus
3L 16819368..16819532 1071..1234 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:19:49 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16802268..16802457 483..672 100 -> Plus
arm_3L 16801522..16801719 1..198 99 -> Plus
arm_3L 16801795..16802078 199..482 100 -> Plus
arm_3L 16812007..16812404 673..1070 100 -> Plus
arm_3L 16812468..16812632 1071..1234 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:13 Download gff for RE55422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16801795..16802078 199..482 100 -> Plus
3L 16802268..16802457 483..672 100 -> Plus
3L 16812007..16812404 673..1070 100 -> Plus
3L 16812468..16812632 1071..1234 99   Plus
3L 16801522..16801719 1..198 99 -> Plus

RE55422.pep Sequence

Translation from 123 to 1121

> RE55422.pep
MAAEEGKFDNILLAVAEKHHGGVPEFLGTLASFLRRKTDFFTGAKQTEWE
KLLLDVFNKESKLAVTENYEKIKAREASQRLKAEKERAERKARKQEIDDN
KICDITDEEAAAIIKEEETKKRQQLLDSAGGEPSASNRDGISKPIEKVDD
ESDKSELGKLMPNAGNGCTLENYTWTQTLEEVELKIPFNLTFGLRARDLV
ISIGKKSLKVGIKGQTPIIDGELCGEVKTEESVWVLQDSKTVMITLDKIN
KMNWWSRLVTTDPEISTRKINPESSKLSDLDGETRSMVEKMMYDQRQKEL
GLPTSEDRKKQDILEKFKQQHPEMDFSKCKFN*

RE55422.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23933-PA 332 GF23933-PA 1..332 1..332 1420 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13580-PA 332 GG13580-PA 1..332 1..332 1602 90.4 Plus
Dere\GG16760-PA 306 GG16760-PA 109..258 144..295 182 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16226-PA 334 GH16226-PA 1..334 1..332 1413 78.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
nudC-PB 332 CG9710-PB 1..332 1..332 1703 100 Plus
nudC-PA 332 CG9710-PA 1..332 1..332 1703 100 Plus
CG31251-PA 306 CG31251-PA 23..258 26..295 194 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13372-PA 334 GI13372-PA 1..334 1..332 1428 79.6 Plus
Dmoj\GI13864-PA 305 GI13864-PA 110..257 142..295 182 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16069-PA 336 GL16069-PA 1..336 1..332 1446 81 Plus
Dper\GL21703-PA 297 GL21703-PA 122..268 166..309 164 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21982-PA 336 GA21982-PA 1..336 1..332 1446 81 Plus
Dpse\GA26376-PA 294 GA26376-PA 119..265 166..309 159 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25659-PA 332 GM25659-PA 1..332 1..332 1679 95.8 Plus
Dsec\GM15349-PA 306 GM15349-PA 103..258 138..295 187 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14666-PA 332 GD14666-PA 1..332 1..332 1662 95.2 Plus
Dsim\GD15097-PA 298 GD15097-PA 101..250 144..295 180 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13202-PA 334 GJ13202-PA 1..334 1..332 1463 81.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12498-PA 326 GK12498-PA 1..326 1..332 1321 75.5 Plus
Dwil\GK17436-PA 315 GK17436-PA 1..315 1..332 1247 73.5 Plus
Dwil\GK23802-PA 324 GK23802-PA 1..324 1..331 1127 62.8 Plus
Dwil\GK22475-PA 250 GK22475-PA 1..250 1..312 596 43.3 Plus
Dwil\GK13789-PA 297 GK13789-PA 124..252 166..295 149 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19876-PA 332 GE19876-PA 1..332 1..332 1530 89.8 Plus
Dyak\GE25255-PA 306 GE25255-PA 109..258 144..295 162 33.5 Plus

RE55422.hyp Sequence

Translation from 123 to 1121

> RE55422.hyp
MAAEEGKFDNILLAVAEKHHGGVPEFLGTLASFLRRKTDFFTGAKQTEWE
KLLLDVFNKESKLAVTENYEKIKAREASQRLKAEKERAERKARKQEIDDN
KICDITDEEAAAIIKEEETKKRQQLLDSAGGEPSASNRDGISKPIEKVDD
ESDKSELGKLMPNAGNGCTLENYTWTQTLEEVELKIPFNLTFGLRARDLV
ISIGKKSLKVGIKGQTPIIDGELCGEVKTEESVWVLQDSKTVMITLDKIN
KMNWWSRLVTTDPEISTRKINPESSKLSDLDGETRSMVEKMMYDQRQKEL
GLPTSEDRKKQDILEKFKQQHPEMDFSKCKFN*

RE55422.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
nudC-PB 332 CG9710-PB 1..332 1..332 1703 100 Plus
nudC-PA 332 CG9710-PA 1..332 1..332 1703 100 Plus
CG31251-PA 306 CG31251-PA 23..258 26..295 194 27.4 Plus