Clone RE55455 Report

Search the DGRC for RE55455

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:554
Well:55
Vector:pFlc-1
Associated Gene/Transcriptpall-RA
Protein status:RE55455.pep: gold
Sequenced Size:1198

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3428 2003-01-01 Sim4 clustering to Release 3
pall 2008-04-29 Release 5.5 accounting
pall 2008-08-15 Release 5.9 accounting
pall 2008-12-18 5.12 accounting

Clone Sequence Records

RE55455.complete Sequence

1198 bp (1198 high quality bases) assembled on 2004-12-16

GenBank Submission: BT021260

> RE55455.complete
AATAGCAATATTCTCGACTATAATCGCTCCGCTCGAAACTAGTAATAAGT
ATAAACGAGAAATATGAATCTGTTAGACTTGCCACAAACACTAATTCAGG
ACATTTTGGAGTTGCTCCCCTACGACGAGGTGGCAAAAAAACGAGAGGTG
TGCACTCTATTTAATTATCTTGGGCAGCAAATATTAAACAAGGGTTTTAA
CAAGATCATTATGGCCCATGCCAAGAACTTCAAGCGCATCAAATCCATGC
TGCCACGACGGGAATCGGAACGCAGGAACCACATTCTATCCCGCCACTCG
GACATACTTACCTCGATCGAAACACGGATCTCGATGCTGACCATGACGTA
CTCCAAGTTTATTGACCTCAACATCTGCTGTTTCATACCTGGTCGCGTTC
TGGACGAGATCAACAGCATCCTGCGCATTTTGAGCACCTCCACTAAACAG
CTGCGACCACATGAAGTGCTGCAGGAGCTGCGCGACATCTCCTCCATGGC
CATTGAGCATTTCGACGAAAAGATTGCTGTGAATTTCAAATTGGAACACC
GAAAACAATTGGCGGAATCCACGGCGGCCGGAGCTCGACTTGTGGTTTGC
AGTGCCTTGGGCGACATAAGCTTTAGTGGCGTAAGGCGAACCGGAATCAG
TCGTCCCGTAGATCATGGGCTCGTCCAGCAGGCTATCGTTCAGTTGGCCC
CCATATCTGCCAGCAAATCACACTCTGATTCCTCTCAAAAGGATCGCATG
TCTAAACAACTGTTCAAGCAATACCAGCTCCAAAGGTCACTTTCGCAAAA
GATTCGCCTCTTGGAAGTGTCGCGCAAGGTGCAGGATCGCCGATTGCAGG
AAGCCCTATCCAGCATCACCGAACTGACCACCCAAGTGTCCGAACTTAAG
CGCCAAATGGAGGATGTGGTGGCCAATATGCCCAGTTGCGCTGTTAAACG
TCAGGCTGTCGCCAGCGCGGACTGCTTACCACCGGCCCTGAAAAAACCCA
AGGTGTAGCCAAGGATTAGCAATACTAAATAGCTTTTAAATAAAACTTCC
CTCCAGATGGTGTAGCTGGAGTACGTAGCATTAATTAGGCAGTGCATCTT
CGATATATCGCGTTAAGATTTATTGTTGCACTTGTTACTTAAATATTGTA
TTACTACTATATAAATACATTGAACATCTAGTAAAAAAAAAAAAAAAA

RE55455.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
pall-RA 1334 pall-RA 141..1327 1..1187 5920 99.9 Plus
Jarid2-RD 8490 Jarid2-RD 8394..8490 1187..1091 470 98.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9478331..9479240 1182..273 4550 100 Minus
chr3L 24539361 chr3L 9479500..9479649 150..1 750 100 Minus
chr3L 24539361 chr3L 9479306..9479436 276..146 655 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9486444..9487358 1187..273 4560 99.9 Minus
3L 28110227 3L 9487618..9487767 150..1 750 100 Minus
3L 28110227 3L 9487424..9487554 276..146 655 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9479544..9480458 1187..273 4560 99.8 Minus
3L 28103327 3L 9480718..9480867 150..1 750 100 Minus
3L 28103327 3L 9480524..9480654 276..146 655 100 Minus
Blast to na_te.dros performed 2019-03-16 23:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 2968..3071 927..1033 113 60.2 Plus

RE55455.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:16:08 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9478331..9479237 276..1182 100 <- Minus
chr3L 9479307..9479434 148..275 100 <- Minus
chr3L 9479503..9479649 1..147 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:06 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..945 64..1008 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:03 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..945 64..1008 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:19:51 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..945 64..1008 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:00 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..945 64..1008 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:32 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..945 64..1008 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:23:11 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..1182 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:03 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..1182 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:19:51 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 24..1205 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:00 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 1..1182 1..1182 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:32 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
pall-RA 24..1205 1..1182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:08 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9487621..9487767 1..147 100   Minus
3L 9486449..9487355 276..1182 100 <- Minus
3L 9487425..9487552 148..275 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:08 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9487621..9487767 1..147 100   Minus
3L 9486449..9487355 276..1182 100 <- Minus
3L 9487425..9487552 148..275 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:08 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9487621..9487767 1..147 100   Minus
3L 9486449..9487355 276..1182 100 <- Minus
3L 9487425..9487552 148..275 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:19:51 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9479549..9480455 276..1182 100 <- Minus
arm_3L 9480525..9480652 148..275 100 <- Minus
arm_3L 9480721..9480867 1..147 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:23 Download gff for RE55455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9480721..9480867 1..147 100   Minus
3L 9480525..9480652 148..275 100 <- Minus
3L 9479549..9480455 276..1182 100 <- Minus

RE55455.pep Sequence

Translation from 63 to 1007

> RE55455.pep
MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIM
AHAKNFKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFI
DLNICCFIPGRVLDEINSILRILSTSTKQLRPHEVLQELRDISSMAIEHF
DEKIAVNFKLEHRKQLAESTAAGARLVVCSALGDISFSGVRRTGISRPVD
HGLVQQAIVQLAPISASKSHSDSSQKDRMSKQLFKQYQLQRSLSQKIRLL
EVSRKVQDRRLQEALSSITELTTQVSELKRQMEDVVANMPSCAVKRQAVA
SADCLPPALKKPKV*

RE55455.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24660-PA 316 GF24660-PA 1..316 1..314 1371 81 Plus
Dana\GF13725-PA 605 GF13725-PA 124..276 2..154 327 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14032-PA 314 GG14032-PA 1..314 1..314 1577 95.5 Plus
Dere\GG24142-PA 604 GG24142-PA 123..274 3..154 306 40.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16208-PA 313 GH16208-PA 1..311 1..313 941 59.5 Plus
Dgri\GH22835-PA 595 GH22835-PA 71..224 1..154 302 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
pall-PA 314 CG3428-PA 1..314 1..314 1556 100 Plus
dmpd-PB 603 CG11866-PB 121..382 2..284 305 30.2 Plus
dmpd-PA 603 CG11866-PA 121..382 2..284 305 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13354-PA 351 GI13354-PA 1..351 1..314 965 56.3 Plus
Dmoj\GI21213-PA 559 GI21213-PA 66..219 1..154 308 40.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20033-PA 579 GL20033-PA 95..247 2..154 325 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11246-PA 579 GA11246-PA 95..247 2..154 326 41.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24866-PA 307 GM24866-PA 1..307 1..314 1587 97.1 Plus
Dsec\GM21188-PA 601 GM21188-PA 118..271 1..154 311 40.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12918-PA 475 GD12918-PA 190..475 29..314 1470 97.9 Plus
Dsim\GD12918-PA 475 GD12918-PA 1..190 1..190 1010 98.9 Plus
Dsim\GD10716-PA 601 GD10716-PA 118..271 1..154 312 40.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13184-PA 342 GJ13184-PA 1..342 1..314 1030 61.3 Plus
Dvir\GJ20816-PA 577 GJ20816-PA 56..209 1..154 297 39.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20333-PA 340 GK20333-PA 1..339 1..314 1109 66.3 Plus
Dwil\GK21976-PA 608 GK21976-PA 98..251 1..154 312 40.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21235-PA 314 GE21235-PA 19..314 19..314 1507 95.9 Plus
Dyak\GE19340-PA 605 GE19340-PA 123..275 2..154 307 39.9 Plus

RE55455.hyp Sequence

Translation from 63 to 1007

> RE55455.hyp
MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIM
AHAKNFKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFI
DLNICCFIPGRVLDEINSILRILSTSTKQLRPHEVLQELRDISSMAIEHF
DEKIAVNFKLEHRKQLAESTAAGARLVVCSALGDISFSGVRRTGISRPVD
HGLVQQAIVQLAPISASKSHSDSSQKDRMSKQLFKQYQLQRSLSQKIRLL
EVSRKVQDRRLQEALSSITELTTQVSELKRQMEDVVANMPSCAVKRQAVA
SADCLPPALKKPKV*

RE55455.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
pall-PA 314 CG3428-PA 1..314 1..314 1556 100 Plus
dmpd-PB 603 CG11866-PB 121..382 2..284 305 30.2 Plus
dmpd-PA 603 CG11866-PA 121..382 2..284 305 30.2 Plus