Clone RE55472 Report

Search the DGRC for RE55472

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:554
Well:72
Vector:pFlc-1
Associated Gene/TranscriptDet-RA
Protein status:RE55472.pep: gold
Preliminary Size:598
Sequenced Size:640

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12265 2001-12-14 Blastp of sequenced clone
CG12265 2002-01-01 Sim4 clustering to Release 2
CG12265 2003-01-01 Sim4 clustering to Release 3
CG12265 2008-04-29 Release 5.5 accounting
CG12265 2008-08-15 Release 5.9 accounting
Det 2008-12-18 5.12 accounting

Clone Sequence Records

RE55472.complete Sequence

640 bp (640 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071487

> RE55472.complete
ACAGCAACAACGACGCGCTGTTTGCGATAAAAAACCCAAAATAAGTATTT
CGCTTTAAAACTGTTTATTAAAAGGATATGGAATCGCCAGTGGTAAACGA
AGTTGCAGCCAGCTTGGGCGGTGAAAAGCTGGAGGTCTTTCGCAAGCTGA
ACCTCCTGGAACAGCATCGCGTGGAGAGCTACAAGAGTTGGCCCTTTCCG
GAGACCGCATCCTGCAGCATTTCGAAGATGGCCGAGGCGGGATTCTATTG
GACGGGCACCAAGCGGGAAAACGACACTGCCACTTGTTTTGTGTGCGGAA
AGACCCTGGATGGCTGGGAGCCCGAAGATGATCCGTGGAAGGAGCACGTG
AAACATGCACCCCAATGCGAGTTCGCCAAGCTATCGTGTCCCGAAAGGAA
TTTAACCGTATCACAATTTCTGGAAATTCTTGGAACCGTCGTTAAAGGCA
GCATAGAGAAAACCTGCAAAGCCTTCAAATCGAGCTTCGTTCGGGAGAAT
GAGAAGCGTCTAGATGAGTTTACGCGTAATCAAAAATAGAGCGCTAATTT
TTAAACCTTAAATATACATATATAAAACTCGCTATTTATCAAGATTTTTA
ATAAAACGCAATGTTAGTCCATCGGAAAAAAAAAAAAAAA

RE55472.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Det-RA 701 Det-RA 47..670 1..624 3120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12974111..12974337 1..227 1135 100 Plus
chr3R 27901430 chr3R 12974650..12974866 408..624 1070 99.5 Plus
chr3R 27901430 chr3R 12974413..12974598 226..411 915 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17149694..17149920 1..227 1135 100 Plus
3R 32079331 3R 17150239..17150455 408..624 1085 100 Plus
3R 32079331 3R 17149996..17150181 226..411 930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16890525..16890751 1..227 1135 100 Plus
3R 31820162 3R 16891070..16891286 408..624 1085 100 Plus
3R 31820162 3R 16890827..16891012 226..411 930 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:37:54 has no hits.

RE55472.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:46 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12974111..12974337 1..227 100 -> Plus
chr3R 12974415..12974594 228..407 99 -> Plus
chr3R 12974650..12974866 408..625 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:08 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 1..462 78..539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:46 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 1..462 78..539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:28:00 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 1..462 78..539 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:14:27 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
CG12265-RA 1..462 78..539 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:44 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 1..462 78..539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:59 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 1..624 1..625 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:46 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 26..649 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:28:00 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 28..651 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:14:27 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
CG12265-RA 1..624 1..625 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:44 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
Det-RA 28..651 1..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:46 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17149694..17149920 1..227 100 -> Plus
3R 17149998..17150177 228..407 100 -> Plus
3R 17150239..17150455 408..625 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:46 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17149694..17149920 1..227 100 -> Plus
3R 17149998..17150177 228..407 100 -> Plus
3R 17150239..17150455 408..625 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:46 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17149694..17149920 1..227 100 -> Plus
3R 17149998..17150177 228..407 100 -> Plus
3R 17150239..17150455 408..625 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:28:00 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12975416..12975642 1..227 100 -> Plus
arm_3R 12975720..12975899 228..407 100 -> Plus
arm_3R 12975961..12976177 408..625 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:47:22 Download gff for RE55472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16890525..16890751 1..227 100 -> Plus
3R 16890829..16891008 228..407 100 -> Plus
3R 16891070..16891286 408..625 99   Plus

RE55472.pep Sequence

Translation from 77 to 538

> RE55472.pep
MESPVVNEVAASLGGEKLEVFRKLNLLEQHRVESYKSWPFPETASCSISK
MAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFA
KLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVRENEKRLDEFTR
NQK*

RE55472.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18137-PA 149 GF18137-PA 1..145 5..149 562 67.6 Plus
Dana\GF17464-PA 5004 GF17464-PA 257..330 28..101 162 37.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22093-PA 153 GG22093-PA 1..153 1..153 782 94.8 Plus
Dere\GG17289-PA 4877 GG17289-PA 248..321 28..101 161 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13432-PA 141 GH13432-PA 6..141 17..152 543 69.9 Plus
Dgri\GH18453-PA 4852 GH18453-PA 242..321 22..101 161 37.5 Plus
Dgri\GH15404-PA 449 GH15404-PA 216..291 27..107 144 35.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Det-PA 153 CG12265-PA 1..153 1..153 822 100 Plus
Bruce-PC 4852 CG6303-PC 248..321 28..101 157 37.8 Plus
Bruce-PE 4865 CG6303-PE 248..321 28..101 157 37.8 Plus
Bruce-PD 4875 CG6303-PD 248..321 28..101 157 37.8 Plus
Bruce-PA 4876 CG6303-PA 248..321 28..101 157 37.8 Plus
Bruce-PB 4976 CG6303-PB 248..321 28..101 157 37.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24770-PA 147 GI24770-PA 2..146 8..152 555 67.6 Plus
Dmoj\GI24031-PA 551 GI24031-PA 248..321 28..101 164 37.8 Plus
Dmoj\GI13007-PA 443 GI13007-PA 207..277 27..102 140 36.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23676-PA 152 GL23676-PA 15..152 15..152 613 79 Plus
Dper\GL23835-PA 4950 GL23835-PA 244..317 28..101 161 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11519-PA 152 GA11519-PA 15..152 15..152 608 78.3 Plus
Dpse\Bruce-PA 4956 GA19502-PA 244..317 28..101 161 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15217-PA 153 GM15217-PA 1..153 1..153 805 98.7 Plus
Dsec\GM26173-PA 3066 GM26173-PA 248..321 28..101 161 37.8 Plus
Dsec\GM16262-PA 341 GM16262-PA 46..125 22..101 151 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19147-PA 154 GD19147-PA 1..154 1..153 791 98.1 Plus
Dsim\GD20723-PA 4013 GD20723-PA 804..877 28..101 161 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24423-PA 147 GJ24423-PA 11..144 17..150 554 73.9 Plus
Dvir\GJ23660-PA 1826 GJ23660-PA 248..321 28..101 162 37.8 Plus
Dvir\GJ12099-PA 456 GJ12099-PA 194..289 1..102 143 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11633-PA 151 GK11633-PA 16..151 18..153 515 66.2 Plus
Dwil\GK14416-PA 4911 GK14416-PA 253..326 28..101 161 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10116-PA 153 GE10116-PA 1..153 1..153 768 92.8 Plus
Dyak\GE24690-PA 4970 GE24690-PA 248..321 28..101 161 37.8 Plus

RE55472.hyp Sequence

Translation from 77 to 538

> RE55472.hyp
MESPVVNEVAASLGGEKLEVFRKLNLLEQHRVESYKSWPFPETASCSISK
MAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFA
KLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVRENEKRLDEFTR
NQK*

RE55472.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Det-PA 153 CG12265-PA 1..153 1..153 822 100 Plus
Bruce-PC 4852 CG6303-PC 248..321 28..101 157 37.8 Plus
Bruce-PE 4865 CG6303-PE 248..321 28..101 157 37.8 Plus
Bruce-PD 4875 CG6303-PD 248..321 28..101 157 37.8 Plus
Bruce-PA 4876 CG6303-PA 248..321 28..101 157 37.8 Plus