BDGP Sequence Production Resources |
Search the DGRC for RE55472
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 554 |
Well: | 72 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Det-RA |
Protein status: | RE55472.pep: gold |
Preliminary Size: | 598 |
Sequenced Size: | 640 |
Gene | Date | Evidence |
---|---|---|
CG12265 | 2001-12-14 | Blastp of sequenced clone |
CG12265 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12265 | 2003-01-01 | Sim4 clustering to Release 3 |
CG12265 | 2008-04-29 | Release 5.5 accounting |
CG12265 | 2008-08-15 | Release 5.9 accounting |
Det | 2008-12-18 | 5.12 accounting |
640 bp (640 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071487
> RE55472.complete ACAGCAACAACGACGCGCTGTTTGCGATAAAAAACCCAAAATAAGTATTT CGCTTTAAAACTGTTTATTAAAAGGATATGGAATCGCCAGTGGTAAACGA AGTTGCAGCCAGCTTGGGCGGTGAAAAGCTGGAGGTCTTTCGCAAGCTGA ACCTCCTGGAACAGCATCGCGTGGAGAGCTACAAGAGTTGGCCCTTTCCG GAGACCGCATCCTGCAGCATTTCGAAGATGGCCGAGGCGGGATTCTATTG GACGGGCACCAAGCGGGAAAACGACACTGCCACTTGTTTTGTGTGCGGAA AGACCCTGGATGGCTGGGAGCCCGAAGATGATCCGTGGAAGGAGCACGTG AAACATGCACCCCAATGCGAGTTCGCCAAGCTATCGTGTCCCGAAAGGAA TTTAACCGTATCACAATTTCTGGAAATTCTTGGAACCGTCGTTAAAGGCA GCATAGAGAAAACCTGCAAAGCCTTCAAATCGAGCTTCGTTCGGGAGAAT GAGAAGCGTCTAGATGAGTTTACGCGTAATCAAAAATAGAGCGCTAATTT TTAAACCTTAAATATACATATATAAAACTCGCTATTTATCAAGATTTTTA ATAAAACGCAATGTTAGTCCATCGGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Det-RA | 701 | Det-RA | 47..670 | 1..624 | 3120 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 12974111..12974337 | 1..227 | 1135 | 100 | Plus |
chr3R | 27901430 | chr3R | 12974650..12974866 | 408..624 | 1070 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 12974413..12974598 | 226..411 | 915 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 17149694..17149920 | 1..227 | 1135 | 100 | Plus |
3R | 32079331 | 3R | 17150239..17150455 | 408..624 | 1085 | 100 | Plus |
3R | 32079331 | 3R | 17149996..17150181 | 226..411 | 930 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 16890525..16890751 | 1..227 | 1135 | 100 | Plus |
3R | 31820162 | 3R | 16891070..16891286 | 408..624 | 1085 | 100 | Plus |
3R | 31820162 | 3R | 16890827..16891012 | 226..411 | 930 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12974111..12974337 | 1..227 | 100 | -> | Plus |
chr3R | 12974415..12974594 | 228..407 | 99 | -> | Plus |
chr3R | 12974650..12974866 | 408..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 1..462 | 78..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 1..462 | 78..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 1..462 | 78..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12265-RA | 1..462 | 78..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 1..462 | 78..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 1..624 | 1..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 26..649 | 1..624 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 28..651 | 1..624 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12265-RA | 1..624 | 1..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Det-RA | 28..651 | 1..624 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17149694..17149920 | 1..227 | 100 | -> | Plus |
3R | 17149998..17150177 | 228..407 | 100 | -> | Plus |
3R | 17150239..17150455 | 408..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17149694..17149920 | 1..227 | 100 | -> | Plus |
3R | 17149998..17150177 | 228..407 | 100 | -> | Plus |
3R | 17150239..17150455 | 408..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17149694..17149920 | 1..227 | 100 | -> | Plus |
3R | 17149998..17150177 | 228..407 | 100 | -> | Plus |
3R | 17150239..17150455 | 408..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12975416..12975642 | 1..227 | 100 | -> | Plus |
arm_3R | 12975720..12975899 | 228..407 | 100 | -> | Plus |
arm_3R | 12975961..12976177 | 408..625 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16890525..16890751 | 1..227 | 100 | -> | Plus |
3R | 16890829..16891008 | 228..407 | 100 | -> | Plus |
3R | 16891070..16891286 | 408..625 | 99 | Plus |
Translation from 77 to 538
> RE55472.pep MESPVVNEVAASLGGEKLEVFRKLNLLEQHRVESYKSWPFPETASCSISK MAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFA KLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVRENEKRLDEFTR NQK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18137-PA | 149 | GF18137-PA | 1..145 | 5..149 | 562 | 67.6 | Plus |
Dana\GF17464-PA | 5004 | GF17464-PA | 257..330 | 28..101 | 162 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22093-PA | 153 | GG22093-PA | 1..153 | 1..153 | 782 | 94.8 | Plus |
Dere\GG17289-PA | 4877 | GG17289-PA | 248..321 | 28..101 | 161 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13432-PA | 141 | GH13432-PA | 6..141 | 17..152 | 543 | 69.9 | Plus |
Dgri\GH18453-PA | 4852 | GH18453-PA | 242..321 | 22..101 | 161 | 37.5 | Plus |
Dgri\GH15404-PA | 449 | GH15404-PA | 216..291 | 27..107 | 144 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Det-PA | 153 | CG12265-PA | 1..153 | 1..153 | 822 | 100 | Plus |
Bruce-PC | 4852 | CG6303-PC | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PE | 4865 | CG6303-PE | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PD | 4875 | CG6303-PD | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PA | 4876 | CG6303-PA | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PB | 4976 | CG6303-PB | 248..321 | 28..101 | 157 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24770-PA | 147 | GI24770-PA | 2..146 | 8..152 | 555 | 67.6 | Plus |
Dmoj\GI24031-PA | 551 | GI24031-PA | 248..321 | 28..101 | 164 | 37.8 | Plus |
Dmoj\GI13007-PA | 443 | GI13007-PA | 207..277 | 27..102 | 140 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23676-PA | 152 | GL23676-PA | 15..152 | 15..152 | 613 | 79 | Plus |
Dper\GL23835-PA | 4950 | GL23835-PA | 244..317 | 28..101 | 161 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11519-PA | 152 | GA11519-PA | 15..152 | 15..152 | 608 | 78.3 | Plus |
Dpse\Bruce-PA | 4956 | GA19502-PA | 244..317 | 28..101 | 161 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15217-PA | 153 | GM15217-PA | 1..153 | 1..153 | 805 | 98.7 | Plus |
Dsec\GM26173-PA | 3066 | GM26173-PA | 248..321 | 28..101 | 161 | 37.8 | Plus |
Dsec\GM16262-PA | 341 | GM16262-PA | 46..125 | 22..101 | 151 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19147-PA | 154 | GD19147-PA | 1..154 | 1..153 | 791 | 98.1 | Plus |
Dsim\GD20723-PA | 4013 | GD20723-PA | 804..877 | 28..101 | 161 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24423-PA | 147 | GJ24423-PA | 11..144 | 17..150 | 554 | 73.9 | Plus |
Dvir\GJ23660-PA | 1826 | GJ23660-PA | 248..321 | 28..101 | 162 | 37.8 | Plus |
Dvir\GJ12099-PA | 456 | GJ12099-PA | 194..289 | 1..102 | 143 | 31.4 | Plus |
Translation from 77 to 538
> RE55472.hyp MESPVVNEVAASLGGEKLEVFRKLNLLEQHRVESYKSWPFPETASCSISK MAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFA KLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVRENEKRLDEFTR NQK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Det-PA | 153 | CG12265-PA | 1..153 | 1..153 | 822 | 100 | Plus |
Bruce-PC | 4852 | CG6303-PC | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PE | 4865 | CG6303-PE | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PD | 4875 | CG6303-PD | 248..321 | 28..101 | 157 | 37.8 | Plus |
Bruce-PA | 4876 | CG6303-PA | 248..321 | 28..101 | 157 | 37.8 | Plus |