Clone RE55691 Report

Search the DGRC for RE55691

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:556
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCG14545-RA
Protein status:RE55691.pep: gold
Preliminary Size:270
Sequenced Size:829

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14545 2001-12-14 Blastp of sequenced clone
CG14545 2002-01-01 Sim4 clustering to Release 2
CG14545 2003-01-01 Sim4 clustering to Release 3
CG14545 2008-04-29 Release 5.5 accounting
CG14545 2008-08-15 Release 5.9 accounting
CG14545 2008-12-18 5.12 accounting

Clone Sequence Records

RE55691.complete Sequence

829 bp (829 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071494

> RE55691.complete
GCAGCCCTCGCTTTACAGTTATTCCCGCCACCACAAGATCAATTGGAAAT
TTCACAATTTGCCAAATTTATTACCAAATTGGTCGTTTTAAACACGTAAC
ATGTCGGAAAGAGAAGAAGAATCGATTGCATACTTGATGGAAAATGGCAT
TTTCCCTCGACTTCTGGAGATTTTAAAGCAAATGGTGGATATCGATCCGT
TGCCATCGGACCCTCTGATGCACATTTTGCATTTTCTGGGCTGTCCGCTA
ATTCCGCAGGCCCAAATGAAGGCCCTGGAGCGGAAAGTGTCGCGTGCCCA
TGATGAGCTGCGCCATTTGCGCCGTTTGATCATCGATTTGGATGCCTTGG
ATCAGCTTTACGATGGCGAAAACGAAGTGGAGGAGTATGTGGGCAATGTG
GAGGAAGCCGTCTCATCATCGAGCGAAGATTCCATGGTGGAGAGCATTGA
GACTACGATGGACTCCACGAAACCGGAGCTTGGGCTATGTACACCGATGT
CATCGCTCAAGGATTCAAATCCTTCAAATCCATAGATCGCACAGTATCGA
ATCACATTTGTCGTTGAGCCTTTATTATGTACTGGATACATATCTTTGGC
AACTGCATGTGAGTTTTGGATGCATATTTCTATTACATTTTGTTTATTCG
ACGCAATGTGAGATGTAACCTCGACTTTTTATCAAGTGAACGTATAACAT
TGTATTGTGTACATGCCATACTTATCCATTAAAAATTGTTGACCAGCATG
ATGTATGGAAAATGTTTTGTTCCTTTTCATATTAAAAATACTCAATGGAT
TTCTCTTAAAACTAAAAAAAAAAAAAAAA

RE55691.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14545-RA 1048 CG14545-RA 194..1013 1..820 4085 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21673378..21673935 813..256 2775 99.8 Minus
chr3R 27901430 chr3R 21674000..21674259 260..1 1300 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25850403..25850967 820..256 2810 99.8 Minus
3R 32079331 3R 25851032..25851291 260..1 1300 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25591234..25591798 820..256 2810 99.8 Minus
3R 31820162 3R 25591863..25592122 260..1 1300 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:24:19 has no hits.

RE55691.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:25:23 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21673378..21673931 260..813 99 <- Minus
chr3R 21674001..21674259 1..259 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:22 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..435 101..535 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:45 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..435 101..535 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:27:55 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..435 101..535 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:20 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..435 101..535 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:57:54 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..435 101..535 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:52 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..813 1..813 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:45 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..813 1..813 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:27:55 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..813 1..813 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:21 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..813 1..813 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:57:54 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
CG14545-RA 1..813 1..813 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:25:23 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25850410..25850963 260..813 100 <- Minus
3R 25851033..25851291 1..259 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:25:23 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25850410..25850963 260..813 100 <- Minus
3R 25851033..25851291 1..259 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:25:23 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25850410..25850963 260..813 100 <- Minus
3R 25851033..25851291 1..259 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:27:55 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21676132..21676685 260..813 100 <- Minus
arm_3R 21676755..21677013 1..259 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:35 Download gff for RE55691.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25591241..25591794 260..813 100 <- Minus
3R 25591864..25592122 1..259 100   Minus

RE55691.pep Sequence

Translation from 100 to 534

> RE55691.pep
MSEREEESIAYLMENGIFPRLLEILKQMVDIDPLPSDPLMHILHFLGCPL
IPQAQMKALERKVSRAHDELRHLRRLIIDLDALDQLYDGENEVEEYVGNV
EEAVSSSSEDSMVESIETTMDSTKPELGLCTPMSSLKDSNPSNP*

RE55691.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18229-PA 162 GF18229-PA 1..108 1..108 393 69.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12213-PA 144 GG12213-PA 1..144 1..144 565 78.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23392-PA 176 GH23392-PA 1..115 1..107 332 56.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14545-PA 144 CG14545-PA 1..144 1..144 733 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10337-PA 159 GI10337-PA 1..102 1..102 331 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22293-PA 179 GL22293-PA 1..101 1..101 343 64.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13070-PA 179 GA13070-PA 1..101 1..101 340 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10210-PA 132 GM10210-PA 1..132 1..138 587 87.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18162-PA 134 GD18162-PA 1..134 1..138 606 89.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10191-PA 173 GJ10191-PA 1..102 1..102 361 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14386-PA 144 GK14386-PA 1..105 1..105 322 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10658-PA 137 GE10658-PA 1..136 1..143 536 78.3 Plus

RE55691.hyp Sequence

Translation from 100 to 534

> RE55691.hyp
MSEREEESIAYLMENGIFPRLLEILKQMVDIDPLPSDPLMHILHFLGCPL
IPQAQMKALERKVSRAHDELRHLRRLIIDLDALDQLYDGENEVEEYVGNV
EEAVSSSSEDSMVESIETTMDSTKPELGLCTPMSSLKDSNPSNP*

RE55691.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14545-PA 144 CG14545-PA 1..144 1..144 733 100 Plus