Clone RE55741 Report

Search the DGRC for RE55741

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:557
Well:41
Vector:pFlc-1
Associated Gene/TranscriptMp20-RA
Protein status:RE55741.pep: gold
Sequenced Size:891

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4696 2001-12-14 Blastp of sequenced clone
CG4696 2002-01-01 Sim4 clustering to Release 2
CG4696 2003-01-01 Sim4 clustering to Release 3
Mp20 2008-04-29 Release 5.5 accounting
Mp20 2008-08-15 Release 5.9 accounting
Mp20 2008-12-18 5.12 accounting

Clone Sequence Records

RE55741.complete Sequence

891 bp (891 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071496

> RE55741.complete
GTCAGTGTTAGCTTGTCAGAGCTTTAGTGAAGATCCCGCAGGACCCGAAA
CCAAAAACCAAGAATCAAACATGTCTCTTGAGCGTGCCGTTCGTGCCAAG
ATTGCCAGCAAGCGCAATCCCGAGATGGACAAGGAGGCCCAGGAGTGGAT
CGAGGCCATCATTGCCGAGAAGTTCCCCGCCGGCCAGTCCTACGAGGATG
TGCTCAAGGACGGTCAGGTGCTGTGCAAACTGATCAACGTGCTGTCGCCC
AATGCCGTGCCCAAGGTCAACTCCTCGGGCGGCCAGTTCAAGTTCATGGA
GAACATCAACAACTTCCAGAAGGCCCTGAAGGAGTACGGTGTGCCCGACA
TCGATGTCTTCCAGACCGTCGATCTGTACGAGAAGAAGGATATTGCCAAC
GTTACCAACACCATCTTCGCTTTGGGCCGTGCCACCTACAAGCATGCCGA
CTTCAAGGGTCCCTTCCTGGGCCCCAAGCCCGCCGATGAGTGCAAGCGCG
ATTTCACCGAAGAGCAGCTGAAGGCTGGCCAGACCATTGTGGGTCTGCAG
GCCGGTTCCAACAAGGGAGCCACCCAGGCTGGCCAGAACCTCGGCGCTGG
CCGCAAGATCCTGCTCGGCAAGTAAGCGCCAAAGGATGGCCAGGATGTCC
ACACCCTTTTCTACACTTATGCTAAGTGAACACACCCATATATATTTTGT
ATGATGAAAAACATGAAGAACACAATGATATTCCTCACCAAAGCAAAACT
CAACACCAATGAACACACACTCACACAAAACAACACATAAAAGCAACGCA
AAGGCTTGTCGCCTTATATTAAGTATACGCCTAAGTTAATCTATTTATGA
GTACAATAAAGTAATTCAAAGAACCCAAAAAAAAAAAAAAA

RE55741.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Mp20-RB 1273 Mp20-RB 157..1032 2..877 4380 100 Plus
Mp20.c 1968 Mp20.c 157..1032 2..877 4380 100 Plus
Mp20-RA 1273 Mp20-RA 157..1032 2..877 4380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9134678..9135120 434..876 2200 99.8 Plus
chr2R 21145070 chr2R 9134276..9134610 99..433 1645 99.4 Plus
chr2R 21145070 chr2R 9134035..9134133 2..100 495 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13247317..13247760 434..877 2220 100 Plus
2R 25286936 2R 13246915..13247249 99..433 1675 100 Plus
2R 25286936 2R 13246674..13246772 2..100 495 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13248516..13248959 434..877 2220 100 Plus
2R 25260384 2R 13248114..13248448 99..433 1675 100 Plus
2R 25260384 2R 13247873..13247971 2..100 495 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:28:36 has no hits.

RE55741.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:29:21 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9134034..9134133 1..100 99 -> Plus
chr2R 9134278..9134610 101..433 99 -> Plus
chr2R 9134678..9135120 434..876 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:25 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RB 1..555 71..625 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:48 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RB 1..555 71..625 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:20:31 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 1..555 71..625 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:02 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RB 1..555 71..625 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:12:17 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 1..555 71..625 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:27 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 22..897 1..876 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:48 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 22..897 1..876 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:20:31 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 4..879 1..876 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:02 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 22..897 1..876 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:12:17 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
Mp20-RA 4..879 1..876 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:21 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13246673..13246772 1..100 99 -> Plus
2R 13247317..13247759 434..876 100   Plus
2R 13246917..13247249 101..433 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:21 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13246673..13246772 1..100 99 -> Plus
2R 13247317..13247759 434..876 100   Plus
2R 13246917..13247249 101..433 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:21 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13246673..13246772 1..100 99 -> Plus
2R 13247317..13247759 434..876 100   Plus
2R 13246917..13247249 101..433 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:20:31 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9134178..9134277 1..100 99 -> Plus
arm_2R 9134422..9134754 101..433 100 -> Plus
arm_2R 9134822..9135264 434..876 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:47 Download gff for RE55741.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13248116..13248448 101..433 100 -> Plus
2R 13248516..13248958 434..876 100   Plus
2R 13247872..13247971 1..100 99 -> Plus

RE55741.hyp Sequence

Translation from 0 to 624

> RE55741.hyp
SVLACQSFSEDPAGPETKNQESNMSLERAVRAKIASKRNPEMDKEAQEWI
EAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSGGQFKFME
NINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHAD
FKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAG
RKILLGK*

RE55741.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Mp20-PA 184 CG4696-PA 1..184 24..207 945 100 Plus
Mp20-PC 189 CG4696-PC 1..184 24..207 945 100 Plus
CG5023-PA 169 CG5023-PA 4..159 38..194 441 53.5 Plus
Chd64-PB 188 CG14996-PB 4..186 19..201 365 41.4 Plus
Chd64-PC 175 CG14996-PC 3..173 31..201 364 43.7 Plus

RE55741.pep Sequence

Translation from 70 to 624

> RE55741.pep
MSLERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQV
LCKLINVLSPNAVPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTV
DLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADECKRDFTEEQL
KAGQTIVGLQAGSNKGATQAGQNLGAGRKILLGK*

RE55741.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13684-PA 184 GF13684-PA 1..184 1..184 889 90.2 Plus
Dana\GF17639-PA 169 GF17639-PA 4..160 15..172 442 52.5 Plus
Dana\GF23888-PA 188 GF23888-PA 18..188 10..180 388 45.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20371-PA 184 GG20371-PA 1..184 1..184 957 98.9 Plus
Dere\GG23757-PA 169 GG23757-PA 4..160 15..172 449 53.2 Plus
Dere\GG14221-PA 188 GG14221-PA 18..188 10..180 372 43.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21621-PA 184 GH21621-PA 1..184 1..184 899 91.3 Plus
Dgri\GH23202-PA 243 GH23202-PA 78..234 15..172 448 52.5 Plus
Dgri\GH15556-PA 188 GH15556-PA 18..188 10..180 376 44.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Mp20-PA 184 CG4696-PA 1..184 1..184 945 100 Plus
Mp20-PC 189 CG4696-PC 1..184 1..184 945 100 Plus
CG5023-PA 169 CG5023-PA 4..159 15..171 441 53.5 Plus
Chd64-PC 175 CG14996-PC 3..173 8..178 364 43.7 Plus
Chd64-PB 188 CG14996-PB 18..186 10..178 362 44.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20073-PA 184 GI20073-PA 1..184 1..184 903 91.8 Plus
Dmoj\GI22717-PA 169 GI22717-PA 4..160 15..172 452 53.2 Plus
Dmoj\GI16831-PA 188 GI16831-PA 18..188 10..180 384 45.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11002-PA 184 GL11002-PA 1..184 1..184 940 95.7 Plus
Dper\GL12090-PA 266 GL12090-PA 4..158 15..170 429 51.3 Plus
Dper\GL12739-PA 188 GL12739-PA 18..188 10..180 383 44.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18362-PA 184 GA18362-PA 1..184 1..184 940 95.7 Plus
Dpse\GA18602-PA 169 GA18602-PA 4..160 15..172 440 51.9 Plus
Dpse\GA13413-PA 188 GA13413-PA 18..188 10..180 383 44.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21458-PA 216 GM21458-PA 1..196 1..184 799 81.1 Plus
Dsec\GM23099-PA 182 GM23099-PA 17..173 15..172 448 53.2 Plus
Dsec\GM14014-PA 188 GM14014-PA 18..188 10..180 372 43.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10956-PA 184 GD10956-PA 1..184 1..184 958 98.4 Plus
Dsim\GD19339-PA 106 GD19339-PA 1..97 76..172 294 55.7 Plus
Dsim\GD13293-PA 74 GD13293-PA 15..74 121..180 156 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21167-PA 184 GJ21167-PA 1..184 1..184 898 91.8 Plus
Dvir\GJ23442-PA 214 GJ23442-PA 49..205 15..172 450 53.8 Plus
Dvir\GJ12578-PA 188 GJ12578-PA 18..188 10..180 388 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17978-PA 184 GK17978-PA 1..184 1..184 950 97.8 Plus
Dwil\GK22375-PA 169 GK22375-PA 4..160 15..172 438 51.9 Plus
Dwil\GK10106-PA 188 GK10106-PA 18..188 10..180 387 45.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Mp20-PA 184 GE12530-PA 1..184 1..184 949 97.8 Plus
Dyak\GE20649-PA 188 GE20649-PA 18..188 10..180 372 43.7 Plus
Dyak\GE25653-PA 117 GE25653-PA 4..108 15..120 293 50.9 Plus