Clone RE55814 Report

Search the DGRC for RE55814

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:558
Well:14
Vector:pFlc-1
Associated Gene/TranscriptGstO1-RA
Protein status:RE55814.pep: gold
Preliminary Size:954
Sequenced Size:965

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6662 2001-12-14 Blastp of sequenced clone
CG6662 2002-01-01 Sim4 clustering to Release 2
CG6662 2003-01-01 Sim4 clustering to Release 3
CG6662 2008-04-29 Release 5.5 accounting
CG6662 2008-08-15 Release 5.9 accounting
CG6662 2008-12-18 5.12 accounting

Clone Sequence Records

RE55814.complete Sequence

965 bp (965 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071499

> RE55814.complete
AATTGTCATAACCCGCAAAACAGGTTGTGTTCCTTTCCAGAAGAAATTGT
ATTGCCAATATGAGCAATACTCAGCACTTAACTATTGGCTCGCCAAAGCC
CGTATTTCCGGATGATGGGATCTTAAAGCTGTATTCGATGCGCTTTTGCC
CCTATGCACACCGTGTGCACCTGGTCCTGGATGCCAAAAAGATTCCCTAC
CACGCTATCTACATCAATCTTCGCGACAAACCCGAGTGGTTCTCCCTGGT
GAGCAGCTCCACAAAGGTGCCGGCACTGGAGCTGGTCAAGGAACAGGGAA
ATCCTGTGCTGATCGAGTCGCTCATTATTTGTGACTACTTGGACGAAAAG
TATCCGGAGGTGCCATTGTATCCCAAGGATCTGCTTAAAAAAGCCCAGGA
GAAGATTTTAATCGAACGTTTCGGACAGTTCATCAATGCCTTCTACTACC
TGTTGCTGCACGACAATCCCGAGCAGCTGGTTGACACCGATCACTATGCC
GGATTGGTCGTTTATGAGGAGGAACTGAAGCGACGTTGTACCAAGTTCTT
TGGTGGCGACAGCCCAGGCATGCTTGACTACATGATGTGGCCCTGGTGCG
AGCGCTTTGACTCTCTGAAATACACTTTTGAACAAAAATTCGAATTGAGT
CCGGAACGTTTTCCCACTTTGATTAAGTGGCGCGACTTGATGATCCAGGA
TCGTGCTGTCAAGTGTTTCTATCTGGATGGACAGACCCATGCCAAATACA
TGAACTCCCGGCGATCGGGCCAGGCCGATTATAATATGCTATACAATGAG
GCCAAACGTGTCAAATTGGGGTAGTCTACGGGATGATGGCGTTTCCACTT
CAGCATTGTACCTTTTGCACATATAACATGTAACACATGTACCTACTACG
GCAGCATTATTGTGATTGAAAAATAAATCTTTGCATTTTCATTGTTTACA
AAAAAAAAAAAAAAA

RE55814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6662-RA 1066 CG6662-RA 71..1018 1..948 4725 99.8 Plus
CG6662.a 1263 CG6662.a 239..1186 1..948 4725 99.8 Plus
se-RA 910 se-RA 186..296 129..239 195 78.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8516108..8516692 671..87 2910 99.8 Minus
chr3L 24539361 chr3L 8515717..8515871 948..794 775 100 Minus
chr3L 24539361 chr3L 8515927..8516049 793..671 615 100 Minus
chr3L 24539361 chr3L 8516748..8516835 88..1 380 95.5 Minus
chr3L 24539361 chr3L 8512688..8512798 129..239 195 78.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8524134..8524718 671..87 2925 100 Minus
3L 28110227 3L 8523743..8523897 948..794 775 100 Minus
3L 28110227 3L 8523953..8524075 793..671 615 100 Minus
3L 28110227 3L 8524774..8524861 88..1 425 98.9 Minus
3L 28110227 3L 8520715..8520825 129..239 195 78.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8517234..8517818 671..87 2925 100 Minus
3L 28103327 3L 8516843..8516997 948..794 775 100 Minus
3L 28103327 3L 8517053..8517175 793..671 615 100 Minus
3L 28103327 3L 8517874..8517961 88..1 425 98.8 Minus
3L 28103327 3L 8513815..8513925 129..239 195 78.3 Plus
Blast to na_te.dros performed on 2019-03-16 03:40:55 has no hits.

RE55814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:41:37 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8515716..8515871 794..949 99 <- Minus
chr3L 8515927..8516048 672..793 100 <- Minus
chr3L 8516108..8516691 88..671 99 <- Minus
chr3L 8516749..8516835 1..87 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:28 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
CG6662-RA 1..765 60..824 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:35 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
CG6662-RA 1..765 60..824 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:47:59 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
GstO1-RA 1..765 60..824 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:59 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
CG6662-RA 1..765 60..824 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:34 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
GstO1-RA 1..765 60..824 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:52 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
CG6662-RA 1..948 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:35 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
CG6662-RA 1..948 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:47:59 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
GstO1-RA 6..953 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:59 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
CG6662-RA 1..948 1..949 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:34 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
GstO1-RA 6..953 1..949 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:37 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8523742..8523897 794..949 99 <- Minus
3L 8523953..8524074 672..793 100 <- Minus
3L 8524134..8524717 88..671 100 <- Minus
3L 8524775..8524861 1..87 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:37 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8523742..8523897 794..949 99 <- Minus
3L 8523953..8524074 672..793 100 <- Minus
3L 8524134..8524717 88..671 100 <- Minus
3L 8524775..8524861 1..87 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:41:37 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8523742..8523897 794..949 99 <- Minus
3L 8523953..8524074 672..793 100 <- Minus
3L 8524134..8524717 88..671 100 <- Minus
3L 8524775..8524861 1..87 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:47:59 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8516842..8516997 794..949 99 <- Minus
arm_3L 8517053..8517174 672..793 100 <- Minus
arm_3L 8517234..8517817 88..671 100 <- Minus
arm_3L 8517875..8517961 1..87 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:24 Download gff for RE55814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8517234..8517817 88..671 100 <- Minus
3L 8517875..8517961 1..87 98   Minus
3L 8516842..8516997 794..949 99 <- Minus
3L 8517053..8517174 672..793 100 <- Minus

RE55814.pep Sequence

Translation from 59 to 823

> RE55814.pep
MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAI
YINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPE
VPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLV
VYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPER
FPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNMLYNEAKR
VKLG*

RE55814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10159-PA 252 GF10159-PA 1..251 1..253 1024 75.1 Plus
Dana\GF24331-PA 243 GF24331-PA 1..243 1..248 718 54.8 Plus
Dana\GF10160-PA 250 GF10160-PA 7..248 6..246 638 47.1 Plus
Dana\GF24330-PA 243 GF24330-PA 1..240 1..244 630 48.2 Plus
Dana\GF10161-PA 223 GF10161-PA 1..220 27..246 517 45.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15073-PA 254 GG15073-PA 1..254 1..254 1207 87.4 Plus
Dere\GG14321-PA 243 GG14321-PA 1..243 1..248 699 53.2 Plus
Dere\GG14320-PA 241 GG14320-PA 1..240 1..244 695 51.6 Plus
Dere\GG15074-PA 250 GG15074-PA 6..248 5..246 636 48.6 Plus
Dere\GG15075-PA 248 GG15075-PA 9..245 11..246 600 49.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15265-PA 243 GH15265-PA 1..243 1..248 709 53.6 Plus
Dgri\GH15264-PA 241 GH15264-PA 1..240 1..244 658 48.8 Plus
Dgri\GH16193-PA 249 GH16193-PA 6..248 5..247 603 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
GstO1-PA 254 CG6662-PA 1..254 1..254 1370 100 Plus
se-PA 243 CG6781-PA 1..243 1..248 692 52.8 Plus
GstO3-PA 241 CG6776-PA 1..240 1..244 684 50.8 Plus
GstO2-PB 250 CG6673-PB 6..247 5..245 637 48.8 Plus
GstO2-PA 251 CG6673-PA 6..247 5..245 572 45.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11974-PA 243 GI11974-PA 1..243 1..248 697 52.8 Plus
Dmoj\GI11973-PA 241 GI11973-PA 1..240 1..244 665 49.8 Plus
Dmoj\GI13342-PA 251 GI13342-PA 1..248 1..248 632 48.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15565-PA 253 GL15565-PA 1..251 1..252 940 68.3 Plus
Dper\GL15504-PA 243 GL15504-PA 1..243 1..248 709 53.6 Plus
Dper\GL15503-PA 241 GL15503-PA 1..240 1..244 670 51.2 Plus
Dper\GL15567-PA 246 GL15567-PA 5..245 7..246 648 50.6 Plus
Dper\GL15566-PA 250 GL15566-PA 6..248 5..246 638 47.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19760-PA 243 GA19760-PA 1..243 1..244 914 68.4 Plus
Dpse\GA19859-PA 243 GA19859-PA 1..243 1..248 711 53.6 Plus
Dpse\GA23844-PA 241 GA23844-PA 1..240 1..244 661 50.8 Plus
Dpse\GA23449-PA 246 GA23449-PA 5..245 7..246 654 51 Plus
Dpse\GA19769-PA 250 GA19769-PA 6..248 5..246 636 47.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24930-PA 254 GM24930-PA 1..254 1..254 1299 94.9 Plus
Dsec\GM25061-PA 241 GM25061-PA 1..240 1..244 687 50.8 Plus
Dsec\GM24931-PA 250 GM24931-PA 6..248 5..246 637 48.6 Plus
Dsec\GM25062-PA 204 GM25062-PA 1..204 1..248 589 48.4 Plus
Dsec\GM24932-PA 224 GM24932-PA 1..220 27..245 523 47.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12978-PA 254 GD12978-PA 1..254 1..254 1283 93.7 Plus
Dsim\GD14100-PA 243 GD14100-PA 1..243 1..248 700 53.2 Plus
Dsim\GD14099-PA 241 GD14099-PA 1..240 1..244 683 51.2 Plus
Dsim\GD12979-PA 250 GD12979-PA 6..248 5..246 636 48.6 Plus
Dsim\GD12980-PA 212 GD12980-PA 1..208 39..245 473 45.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12198-PA 241 GJ12198-PA 1..240 1..244 694 51.4 Plus
Dvir\GJ12199-PA 243 GJ12199-PA 1..243 1..248 681 52.4 Plus
Dvir\GJ13170-PA 249 GJ13170-PA 6..247 5..246 640 47.5 Plus
Dvir\GJ13171-PA 222 GJ13171-PA 1..222 27..247 553 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20538-PA 259 GK20538-PA 1..258 1..253 968 69.4 Plus
Dwil\GK20355-PA 243 GK20355-PA 1..243 1..248 680 52 Plus
Dwil\GK20539-PA 251 GK20539-PA 7..249 5..246 666 50.2 Plus
Dwil\GK20354-PA 238 GK20354-PA 6..237 3..238 628 50 Plus
Dwil\GK20540-PA 239 GK20540-PA 1..238 10..246 616 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21296-PA 254 GE21296-PA 1..254 1..254 1157 84.3 Plus
Dyak\GE20749-PA 243 GE20749-PA 1..243 1..248 697 53.2 Plus
Dyak\GE20748-PA 241 GE20748-PA 1..240 1..244 696 52.5 Plus
Dyak\GE21297-PA 250 GE21297-PA 6..248 5..246 633 48.1 Plus
Dyak\GE21298-PA 224 GE21298-PA 1..221 27..246 539 47.7 Plus

RE55814.hyp Sequence

Translation from 59 to 823

> RE55814.hyp
MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAI
YINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPE
VPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLV
VYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPER
FPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNMLYNEAKR
VKLG*

RE55814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
GstO1-PA 254 CG6662-PA 1..254 1..254 1370 100 Plus
se-PA 243 CG6781-PA 1..243 1..248 692 52.8 Plus
GstO3-PA 241 CG6776-PA 1..240 1..244 684 50.8 Plus
GstO2-PB 250 CG6673-PB 6..247 5..245 637 48.8 Plus
GstO2-PA 251 CG6673-PA 6..247 5..245 572 45.9 Plus