Clone RE55916 Report

Search the DGRC for RE55916

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:559
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG7685-RA
Protein status:RE55916.pep: gold
Preliminary Size:642
Sequenced Size:885

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7685 2001-12-14 Blastp of sequenced clone
CG7685 2002-01-01 Sim4 clustering to Release 2
CG7685 2003-01-01 Sim4 clustering to Release 3
CG7685 2008-04-29 Release 5.5 accounting
CG7685 2008-08-15 Release 5.9 accounting
CG7685 2008-12-18 5.12 accounting

Clone Sequence Records

RE55916.complete Sequence

885 bp (885 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071502

> RE55916.complete
ATTACTTGGCCAGAGCGAAAAAACAAGGACAATATGCGTAAGACGTGGGT
GAAGCGAGAGAATATATACTTCAAGCCCTTCTACAAGCAGAAGTCGAAGA
TGTTCCTGCTGCTGATCTTCCTGGTCGGAATTTCGTTCATCGCGTATCAG
GCCTTCTCGCTGAACCAGCTGCCCGGAGTGCCTGCTCCGTGGAATCTGCA
GCAGATCAAGCGCAAGCACCAGCAGATGATGCAGTCCCTGGGCAGCAAAC
AGCGCGACGTGGACGATTTCGATGGCGGAGGCGCCGATGCAGTTGCTCCG
GCAGGCGGGGAAACCTCACCTGTTGCGGGTCACGAGGATCCCATCAAGAT
TGTCAGGGGCACACGGCTCTTCGACTACGACGCCTACAAGCCCAACTTCG
AGGGCAAGTTCCGGTGTCTGGACGGCTCCAAAGAGATCCCGTTCGACCAC
CTGAACGACAACTACTGCGACTGTGAGGAGGACGGCAGCGACGAGCCCAG
CACGAATGCCTGCGCCAAGGGGCGATTCTACTGTCGCTACCAGAAGCGTC
ACATCACGGGCCGGGGCCTGGATATCTACGTGGCCAGCAGCCGCATTAAT
GACCACGTGTGCGACTGCTGCGACGGCAGCGATGAGTGGAGCACGGCGAC
CAAGTGTCCCAACGACTGTGCGTAGTCGCAGGCCGACGGGACCCCGTTCC
CACTCCCATTCCTCTTCCATCTCCTCCACCTGTGCACCTAGGACACCAAT
CTCAAGGATGAAGATGTCGGGCGGCGCATCACAAGCGATATTTTTTGTAC
GAGTACAATAGAATTGTAATTTATTTTAAAATAAGTAGATTGAATAAAAG
AAACGAATTCCAAGAAACACAAAAAAAAAAAAAAA

RE55916.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7685-RA 1021 CG7685-RA 115..986 1..872 4360 100 Plus
CG7685.c 926 CG7685.c 67..926 11..870 4300 100 Plus
CG7685.b 1003 CG7685.b 262..968 166..872 3535 100 Plus
CG7685.b 1003 CG7685.b 115..264 1..150 750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14229685..14230200 355..870 2580 100 Plus
chr3R 27901430 chr3R 14229416..14229624 149..357 1030 99.5 Plus
chr3R 27901430 chr3R 14229208..14229358 1..151 755 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18405487..18406004 355..872 2590 100 Plus
3R 32079331 3R 18405218..18405426 149..357 1045 100 Plus
3R 32079331 3R 18405010..18405160 1..151 755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18146318..18146835 355..872 2590 100 Plus
3R 31820162 3R 18146049..18146257 149..357 1045 100 Plus
3R 31820162 3R 18145841..18145991 1..151 755 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:36:33 has no hits.

RE55916.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:37:17 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14229418..14229623 151..356 99 -> Plus
chr3R 14229208..14229357 1..150 100 -> Plus
chr3R 14229687..14230200 357..870 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:34 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..642 34..675 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:09 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..642 34..675 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:35:38 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..642 34..675 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:23 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..642 34..675 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:49:45 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..642 34..675 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:43 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..870 1..870 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:09 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..870 1..870 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:35:38 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 71..940 1..870 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:23 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 1..870 1..870 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:49:45 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
CG7685-RA 71..940 1..870 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:37:17 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18405010..18405159 1..150 100 -> Plus
3R 18405220..18405425 151..356 100 -> Plus
3R 18405489..18406002 357..870 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:37:17 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18405010..18405159 1..150 100 -> Plus
3R 18405220..18405425 151..356 100 -> Plus
3R 18405489..18406002 357..870 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:37:17 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18405010..18405159 1..150 100 -> Plus
3R 18405220..18405425 151..356 100 -> Plus
3R 18405489..18406002 357..870 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:35:38 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14230732..14230881 1..150 100 -> Plus
arm_3R 14230942..14231147 151..356 100 -> Plus
arm_3R 14231211..14231724 357..870 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:48 Download gff for RE55916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18146320..18146833 357..870 100   Plus
3R 18145841..18145990 1..150 100 -> Plus
3R 18146051..18146256 151..356 100 -> Plus

RE55916.hyp Sequence

Translation from 0 to 674

> RE55916.hyp
ITWPERKNKDNMRKTWVKRENIYFKPFYKQKSKMFLLLIFLVGISFIAYQ
AFSLNQLPGVPAPWNLQQIKRKHQQMMQSLGSKQRDVDDFDGGGADAVAP
AGGETSPVAGHEDPIKIVRGTRLFDYDAYKPNFEGKFRCLDGSKEIPFDH
LNDNYCDCEEDGSDEPSTNACAKGRFYCRYQKRHITGRGLDIYVASSRIN
DHVCDCCDGSDEWSTATKCPNDCA*

RE55916.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG7685-PA 213 CG7685-PA 1..213 12..224 1177 100 Plus
CG7685-PB 207 CG7685-PB 1..207 12..224 1131 97.2 Plus
CG6453-PB 548 CG6453-PB 34..130 120..223 250 48.6 Plus
CG6453-PA 548 CG6453-PA 34..130 120..223 250 48.6 Plus

RE55916.pep Sequence

Translation from 33 to 674

> RE55916.pep
MRKTWVKRENIYFKPFYKQKSKMFLLLIFLVGISFIAYQAFSLNQLPGVP
APWNLQQIKRKHQQMMQSLGSKQRDVDDFDGGGADAVAPAGGETSPVAGH
EDPIKIVRGTRLFDYDAYKPNFEGKFRCLDGSKEIPFDHLNDNYCDCEED
GSDEPSTNACAKGRFYCRYQKRHITGRGLDIYVASSRINDHVCDCCDGSD
EWSTATKCPNDCA*

RE55916.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16904-PA 213 GF16904-PA 1..213 1..213 948 82.8 Plus
Dana\GF15099-PA 553 GF15099-PA 36..131 109..212 244 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22902-PA 213 GG22902-PA 1..213 1..213 1143 98.6 Plus
Dere\GG21740-PA 548 GG21740-PA 27..130 104..212 245 48.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18343-PA 208 GH18343-PA 1..208 1..213 815 74.8 Plus
Dgri\GH10155-PA 549 GH10155-PA 28..128 104..212 250 50.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7685-PA 213 CG7685-PA 1..213 1..213 1177 100 Plus
CG7685-PB 207 CG7685-PB 1..207 1..213 1131 97.2 Plus
GCS2beta-PB 548 CG6453-PB 34..130 109..212 250 48.6 Plus
GCS2beta-PA 548 CG6453-PA 34..130 109..212 250 48.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23324-PA 207 GI23324-PA 1..207 1..213 800 73.7 Plus
Dmoj\GI22410-PA 545 GI22410-PA 30..126 108..212 251 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24345-PA 215 GL24345-PA 1..215 1..213 902 79.8 Plus
Dper\GL15951-PA 551 GL15951-PA 33..131 108..213 242 50.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20519-PA 215 GA20519-PA 1..215 1..213 902 79.8 Plus
Dpse\GA19606-PA 551 GA19606-PA 33..131 108..213 242 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17869-PA 191 GM17869-PA 1..191 23..213 1026 99.5 Plus
Dsec\GM17123-PA 548 GM17123-PA 19..130 94..212 244 45 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19231-PA 213 GD19231-PA 1..213 1..213 1146 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10327-PA 205 GJ10327-PA 1..205 1..213 808 72.3 Plus
Dvir\GJ20305-PA 531 GJ20305-PA 11..107 108..212 241 48.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13088-PA 210 GK13088-PA 1..210 1..213 805 73.1 Plus
Dwil\GK24827-PA 552 GK24827-PA 28..126 108..213 244 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25540-PA 213 GE25540-PA 1..213 1..213 1122 96.7 Plus
Dyak\GE13129-PA 548 GE13129-PA 34..130 109..212 236 47.6 Plus