Clone RE56164 Report

Search the DGRC for RE56164

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:561
Well:64
Vector:pFlc-1
Associated Gene/TranscriptNpc2g-RA
Protein status:RE56164.pep: gold
Sequenced Size:614

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11314 2002-09-02 Blastp of sequenced clone
CG11314 2003-01-01 Sim4 clustering to Release 3
CG11314 2008-04-29 Release 5.5 accounting
CG11314 2008-08-15 Release 5.9 accounting
CG11314 2008-12-18 5.12 accounting

Clone Sequence Records

RE56164.complete Sequence

614 bp (614 high quality bases) assembled on 2002-09-02

GenBank Submission: BT001681

> RE56164.complete
GCATTCCGTGTCTGGCTTTCGATCCATCATGTTGCGTCCTAGCTCGCTGC
AGGCTGTCGCCATCGCCATCGTCCTGATCTCGTCATCCGCTTCCGCCGAG
GTGGTCAACTTCGAACCATGTCCGGATAGCGTAGACACCTGTACGATCCA
GCAGGTGAGAGTCTCGCCATGTCCGGAGGCCCTCAACAATGCGGCTTGCA
ATATCCGCCGGAAGCACAACAGTGAGATGAGCTTCGACTTCACGCCGAAC
TTCGATGCCGACACCCTGGTAGCCAGCTTGGGCTGGGCCAAGAGCGAGAA
TGTGGAGCTGCCCCTGCTCACCTTGGACAGCGCCGCCTGCAAGTACACAC
CCTGCCCCGTGAGATCCGGAGTGAAACAGACCTACACCACCCTGGTGCCC
ATCGAGGCCAAGTTTCCCCTGAGTCCGTACACCATCCGTTGGGCTCTGAA
GGATCCCGTCTCCCAGAAGCGCTGCTGCTTCACCATCGACATTAAGGTGG
TGCGCTGATTTGTGCCCACGCTGCATGAGCACTAAATTAAATAGTGAAAT
ATACCTTTTTTCCCAAATAAAATAAATTACCGTGATGTTTAAAAAAAGAA
AAAAAAAAAAAAAA

RE56164.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2g-RA 658 Npc2g-RA 1..593 1..593 2965 100 Plus
Npc2h-RA 810 Npc2h-RA 220..500 226..506 865 87.1 Plus
Npc2h-RB 729 Npc2h-RB 220..322 226..328 395 92.2 Plus
Npc2h-RB 729 Npc2h-RB 337..419 424..506 310 91.5 Plus
Npc2h-RA 810 Npc2h-RA 1..61 1..61 170 85.2 Plus
Npc2h-RB 729 Npc2h-RB 1..61 1..61 170 85.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26567172..26567764 593..1 2950 99.8 Minus
chr3R 27901430 chr3R 26568292..26568791 506..1 935 79.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30744669..30745261 593..1 2965 100 Minus
3R 32079331 3R 30745789..30746288 506..1 935 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30485500..30486092 593..1 2965 100 Minus
3R 31820162 3R 30486620..30486900 506..226 865 87.1 Minus
3R 31820162 3R 30487059..30487119 61..1 170 85.2 Minus
Blast to na_te.dros performed on 2019-03-15 20:24:25 has no hits.

RE56164.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26567167..26567764 1..598 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:45 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
CG11314-RA 1..480 29..508 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:11:14 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2g-RA 1..480 29..508 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:12:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2g-RA 1..480 29..508 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:42:15 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
CG11314-RA 1..480 29..508 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:03 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2g-RA 1..480 29..508 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:02:45 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
CG11314-RA 1..598 1..598 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:11:14 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2g-RA 1..598 1..598 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2g-RA 3..600 1..598 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:42:15 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
CG11314-RA 1..598 1..598 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:03 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2g-RA 3..600 1..598 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30744664..30745261 1..598 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30744664..30745261 1..598 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30744664..30745261 1..598 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:20 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26570386..26570983 1..598 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:19:52 Download gff for RE56164.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30485495..30486092 1..598 99   Minus

RE56164.hyp Sequence

Translation from 0 to 507

> RE56164.hyp
HSVSGFRSIMLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQ
QVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTLVASLGWAKSEN
VELPLLTLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWALK
DPVSQKRCCFTIDIKVVR*

RE56164.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2g-PB 159 CG11314-PB 1..159 10..168 829 100 Plus
Npc2g-PA 159 CG11314-PA 1..159 10..168 829 100 Plus
Npc2h-PC 157 CG11315-PC 1..157 10..168 643 78 Plus
Npc2h-PA 157 CG11315-PA 1..157 10..168 643 78 Plus
Npc2h-PB 130 CG11315-PB 1..130 10..168 497 65.4 Plus

RE56164.pep Sequence

Translation from 28 to 507

> RE56164.pep
MLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPE
ALNNAACNIRRKHNSEMSFDFTPNFDADTLVASLGWAKSENVELPLLTLD
SAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWALKDPVSQKRCC
FTIDIKVVR*

RE56164.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23312-PA 157 GF23312-PA 17..157 19..159 584 78 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11913-PA 161 GG11913-PA 1..161 1..159 720 88.2 Plus
Dere\GG11911-PA 132 GG11911-PA 1..132 1..159 486 61.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14101-PA 133 GH14101-PA 21..133 23..159 376 54.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2g-PB 159 CG11314-PB 1..159 1..159 829 100 Plus
Npc2g-PA 159 CG11314-PA 1..159 1..159 829 100 Plus
Npc2h-PC 157 CG11315-PC 1..157 1..159 643 78 Plus
Npc2h-PA 157 CG11315-PA 1..157 1..159 643 78 Plus
Npc2h-PB 130 CG11315-PB 1..130 1..159 497 65.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10632-PA 131 GI10632-PA 23..131 24..159 331 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13990-PA 160 GL13990-PA 14..160 13..159 555 70.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10910-PA 160 GA10910-PA 14..160 13..159 555 70.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12131-PA 159 GM12131-PA 1..159 1..159 802 95.6 Plus
Dsec\GM12130-PA 130 GM12130-PA 1..130 1..159 506 66 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16847-PA 159 GD16847-PA 1..159 1..159 807 96.2 Plus
Dsim\GD16836-PA 130 GD16836-PA 1..130 1..159 504 66 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22989-PA 157 GJ22989-PA 19..157 21..159 544 72.7 Plus
Dvir\GJ22987-PA 158 GJ22987-PA 21..158 22..159 532 70.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13111-PA 156 GK13111-PA 9..156 12..159 536 65.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23361-PA 159 GE23361-PA 1..159 1..159 757 90.6 Plus
Dyak\GE23360-PA 132 GE23360-PA 1..132 1..159 476 66.7 Plus