BDGP Sequence Production Resources |
Search the DGRC for RE56164
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 561 |
Well: | 64 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Npc2g-RA |
Protein status: | RE56164.pep: gold |
Sequenced Size: | 614 |
Gene | Date | Evidence |
---|---|---|
CG11314 | 2002-09-02 | Blastp of sequenced clone |
CG11314 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11314 | 2008-04-29 | Release 5.5 accounting |
CG11314 | 2008-08-15 | Release 5.9 accounting |
CG11314 | 2008-12-18 | 5.12 accounting |
614 bp (614 high quality bases) assembled on 2002-09-02
GenBank Submission: BT001681
> RE56164.complete GCATTCCGTGTCTGGCTTTCGATCCATCATGTTGCGTCCTAGCTCGCTGC AGGCTGTCGCCATCGCCATCGTCCTGATCTCGTCATCCGCTTCCGCCGAG GTGGTCAACTTCGAACCATGTCCGGATAGCGTAGACACCTGTACGATCCA GCAGGTGAGAGTCTCGCCATGTCCGGAGGCCCTCAACAATGCGGCTTGCA ATATCCGCCGGAAGCACAACAGTGAGATGAGCTTCGACTTCACGCCGAAC TTCGATGCCGACACCCTGGTAGCCAGCTTGGGCTGGGCCAAGAGCGAGAA TGTGGAGCTGCCCCTGCTCACCTTGGACAGCGCCGCCTGCAAGTACACAC CCTGCCCCGTGAGATCCGGAGTGAAACAGACCTACACCACCCTGGTGCCC ATCGAGGCCAAGTTTCCCCTGAGTCCGTACACCATCCGTTGGGCTCTGAA GGATCCCGTCTCCCAGAAGCGCTGCTGCTTCACCATCGACATTAAGGTGG TGCGCTGATTTGTGCCCACGCTGCATGAGCACTAAATTAAATAGTGAAAT ATACCTTTTTTCCCAAATAAAATAAATTACCGTGATGTTTAAAAAAAGAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2g-RA | 658 | Npc2g-RA | 1..593 | 1..593 | 2965 | 100 | Plus |
Npc2h-RA | 810 | Npc2h-RA | 220..500 | 226..506 | 865 | 87.1 | Plus |
Npc2h-RB | 729 | Npc2h-RB | 220..322 | 226..328 | 395 | 92.2 | Plus |
Npc2h-RB | 729 | Npc2h-RB | 337..419 | 424..506 | 310 | 91.5 | Plus |
Npc2h-RA | 810 | Npc2h-RA | 1..61 | 1..61 | 170 | 85.2 | Plus |
Npc2h-RB | 729 | Npc2h-RB | 1..61 | 1..61 | 170 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 30485500..30486092 | 593..1 | 2965 | 100 | Minus |
3R | 31820162 | 3R | 30486620..30486900 | 506..226 | 865 | 87.1 | Minus |
3R | 31820162 | 3R | 30487059..30487119 | 61..1 | 170 | 85.2 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26567167..26567764 | 1..598 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11314-RA | 1..480 | 29..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2g-RA | 1..480 | 29..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2g-RA | 1..480 | 29..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11314-RA | 1..480 | 29..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2g-RA | 1..480 | 29..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11314-RA | 1..598 | 1..598 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2g-RA | 1..598 | 1..598 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2g-RA | 3..600 | 1..598 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11314-RA | 1..598 | 1..598 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2g-RA | 3..600 | 1..598 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30744664..30745261 | 1..598 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30744664..30745261 | 1..598 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30744664..30745261 | 1..598 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26570386..26570983 | 1..598 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30485495..30486092 | 1..598 | 99 | Minus |
Translation from 0 to 507
> RE56164.hyp HSVSGFRSIMLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQ QVRVSPCPEALNNAACNIRRKHNSEMSFDFTPNFDADTLVASLGWAKSEN VELPLLTLDSAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWALK DPVSQKRCCFTIDIKVVR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2g-PB | 159 | CG11314-PB | 1..159 | 10..168 | 829 | 100 | Plus |
Npc2g-PA | 159 | CG11314-PA | 1..159 | 10..168 | 829 | 100 | Plus |
Npc2h-PC | 157 | CG11315-PC | 1..157 | 10..168 | 643 | 78 | Plus |
Npc2h-PA | 157 | CG11315-PA | 1..157 | 10..168 | 643 | 78 | Plus |
Npc2h-PB | 130 | CG11315-PB | 1..130 | 10..168 | 497 | 65.4 | Plus |
Translation from 28 to 507
> RE56164.pep MLRPSSLQAVAIAIVLISSSASAEVVNFEPCPDSVDTCTIQQVRVSPCPE ALNNAACNIRRKHNSEMSFDFTPNFDADTLVASLGWAKSENVELPLLTLD SAACKYTPCPVRSGVKQTYTTLVPIEAKFPLSPYTIRWALKDPVSQKRCC FTIDIKVVR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23312-PA | 157 | GF23312-PA | 17..157 | 19..159 | 584 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11913-PA | 161 | GG11913-PA | 1..161 | 1..159 | 720 | 88.2 | Plus |
Dere\GG11911-PA | 132 | GG11911-PA | 1..132 | 1..159 | 486 | 61.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14101-PA | 133 | GH14101-PA | 21..133 | 23..159 | 376 | 54.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2g-PB | 159 | CG11314-PB | 1..159 | 1..159 | 829 | 100 | Plus |
Npc2g-PA | 159 | CG11314-PA | 1..159 | 1..159 | 829 | 100 | Plus |
Npc2h-PC | 157 | CG11315-PC | 1..157 | 1..159 | 643 | 78 | Plus |
Npc2h-PA | 157 | CG11315-PA | 1..157 | 1..159 | 643 | 78 | Plus |
Npc2h-PB | 130 | CG11315-PB | 1..130 | 1..159 | 497 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10632-PA | 131 | GI10632-PA | 23..131 | 24..159 | 331 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13990-PA | 160 | GL13990-PA | 14..160 | 13..159 | 555 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10910-PA | 160 | GA10910-PA | 14..160 | 13..159 | 555 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12131-PA | 159 | GM12131-PA | 1..159 | 1..159 | 802 | 95.6 | Plus |
Dsec\GM12130-PA | 130 | GM12130-PA | 1..130 | 1..159 | 506 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16847-PA | 159 | GD16847-PA | 1..159 | 1..159 | 807 | 96.2 | Plus |
Dsim\GD16836-PA | 130 | GD16836-PA | 1..130 | 1..159 | 504 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22989-PA | 157 | GJ22989-PA | 19..157 | 21..159 | 544 | 72.7 | Plus |
Dvir\GJ22987-PA | 158 | GJ22987-PA | 21..158 | 22..159 | 532 | 70.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13111-PA | 156 | GK13111-PA | 9..156 | 12..159 | 536 | 65.5 | Plus |