Clone RE56765 Report

Search the DGRC for RE56765

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:567
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG13599-RA
Protein status:RE56765.pep: gold
Preliminary Size:888
Sequenced Size:1062

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13599 2002-10-09 Blastp of sequenced clone
CG13599 2003-01-01 Sim4 clustering to Release 3
CG13599 2008-04-29 Release 5.5 accounting
CG13599 2008-08-15 Release 5.9 accounting
CG13599 2008-12-18 5.12 accounting

Clone Sequence Records

RE56765.complete Sequence

1062 bp (1062 high quality bases) assembled on 2002-10-09

GenBank Submission: BT001683

> RE56765.complete
TGGGTCTGGCAACGTTTGCAATTAGTGCGAAAAGAGCATTTGTTTAAATT
TGTTATATTGCGACCTTTTAATGGATCAAAATGTCAAGAATGTTGATCTT
AAACTGGATAACATTGAGGTTCTGACCAGTGGGACAACAGCGGAGTTCGT
GAATGGCATCCTGGACTTCTTGCTCTATCAACGCCGGCAAATCCCCTTCG
TGTACAAAACATACAAATATTATGTGGATAAATGGTCAGATGCTGATGAA
TCGGGAGAATCCAAGGATCAGGAGTCCTTTGCTCATTACCAACGCAACCA
GCAGCGCTCTAAGGCAAAGGCCACCAAGGAATCTATTAGTGACATGAGAG
AGATCATCCGACAAGCCTTCAGGAGCTCTGAAGTGAAGAGCCTGCGATTT
CTTTTTGGCAACAATATGTTCATGCCCTCGGAGGCCTATACTCTGCACAT
ACCACATGATTCCATATCCAGAGATCACTATTGCGAGCACCATGCTCTGC
CCGAAGGTCGCATCAACCAGGCGCTGCTCCGCCTGCTCACCTGCGAGGAG
CTGTACAGGCTATTCTCCACCGAACTAAAAGTCACCAACGTGTTTCTAGA
AATGGAGCTCCTTACAGACTCCGATCGACCCCAAGGATCCCATTGTGACT
CCTTTAATCTAATCCCAAAGCATATATTAAGCCAACTTCCGCGCAGCTGC
AAGAACATACACCTGCATCTACTGCATTGCAGTGAAAACACACCGAATGA
ATTACGCTGCTGCAAGGAGATGGATATTTACCACGATCTTGGCGTGCGGA
ATCTGGATAAATCTGGGGAAGACGTTAGCCAGACCAACGAAGAGCATGAC
GTTTTGAAAGCAGCAAATGAAACCAGCGGTTGGTGGCAGGCCGAGGTCAT
AGTTCGCGGTTTCAGAGCTCCTGGCAACCAAAAATCGGGAGATTTGTGGT
CTAGCTAACATTTTATAACTTGGATTCTTGCTATTCGGCGTGTTTTGTGT
CAAAAATAAAGTTTCGAATCGTTTATAAAAAAAAAAAAAAAAAAAGAAAA
AAAAAAAAAAAA

RE56765.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13599-RA 1051 CG13599-RA 30..1051 4..1026 5075 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19755500..19756175 351..1027 3275 99.3 Plus
chr3R 27901430 chr3R 19755093..19755441 4..352 1670 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23932054..23932729 351..1027 3335 99.9 Plus
3R 32079331 3R 23931646..23931994 4..352 1745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23672885..23673560 351..1027 3345 99.8 Plus
3R 31820162 3R 23672477..23672825 4..352 1745 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:20:40 has no hits.

RE56765.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:21:19 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19755090..19755441 1..352 98 -> Plus
chr3R 19755502..19756174 353..1026 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:09 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..888 71..958 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:21 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..888 71..958 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:34 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..888 71..958 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:28 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..888 71..958 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:16 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..888 71..958 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:01:10 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..1025 1..1026 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:20 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..1025 1..1026 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:34 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 5..1029 1..1026 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:28 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 1..1025 1..1026 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:16 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13599-RA 5..1029 1..1026 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:19 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23931643..23931994 1..352 99 -> Plus
3R 23932056..23932728 353..1026 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:19 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23931643..23931994 1..352 99 -> Plus
3R 23932056..23932728 353..1026 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:19 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23931643..23931994 1..352 99 -> Plus
3R 23932056..23932728 353..1026 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:34 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19757365..19757716 1..352 99 -> Plus
arm_3R 19757778..19758450 353..1026 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:12:39 Download gff for RE56765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23672474..23672825 1..352 99 -> Plus
3R 23672887..23673559 353..1026 99   Plus

RE56765.pep Sequence

Translation from 70 to 957

> RE56765.pep
MDQNVKNVDLKLDNIEVLTSGTTAEFVNGILDFLLYQRRQIPFVYKTYKY
YVDKWSDADESGESKDQESFAHYQRNQQRSKAKATKESISDMREIIRQAF
RSSEVKSLRFLFGNNMFMPSEAYTLHIPHDSISRDHYCEHHALPEGRINQ
ALLRLLTCEELYRLFSTELKVTNVFLEMELLTDSDRPQGSHCDSFNLIPK
HILSQLPRSCKNIHLHLLHCSENTPNELRCCKEMDIYHDLGVRNLDKSGE
DVSQTNEEHDVLKAANETSGWWQAEVIVRGFRAPGNQKSGDLWSS*

RE56765.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17978-PA 289 GF17978-PA 1..289 1..295 1115 68.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11237-PA 290 GG11237-PA 1..290 1..295 1374 86.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21185-PA 279 GH21185-PA 1..279 1..295 847 55.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13599-PA 295 CG13599-PA 1..295 1..295 1566 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10481-PA 278 GI10481-PA 1..277 1..294 869 58.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23380-PA 287 GL23380-PA 1..287 1..295 987 64.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12392-PA 287 GA12392-PA 1..287 1..295 979 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26538-PA 291 GM26538-PA 1..291 1..295 1457 91.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21046-PA 295 GD21046-PA 1..295 1..295 1530 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23162-PA 280 GJ23162-PA 1..280 1..295 853 56.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22653-PA 275 GK22653-PA 1..275 1..295 770 54.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23429-PA 295 GE23429-PA 1..295 1..295 1467 90.5 Plus

RE56765.hyp Sequence

Translation from 70 to 957

> RE56765.hyp
MDQNVKNVDLKLDNIEVLTSGTTAEFVNGILDFLLYQRRQIPFVYKTYKY
YVDKWSDADESGESKDQESFAHYQRNQQRSKAKATKESISDMREIIRQAF
RSSEVKSLRFLFGNNMFMPSEAYTLHIPHDSISRDHYCEHHALPEGRINQ
ALLRLLTCEELYRLFSTELKVTNVFLEMELLTDSDRPQGSHCDSFNLIPK
HILSQLPRSCKNIHLHLLHCSENTPNELRCCKEMDIYHDLGVRNLDKSGE
DVSQTNEEHDVLKAANETSGWWQAEVIVRGFRAPGNQKSGDLWSS*

RE56765.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13599-PA 295 CG13599-PA 1..295 1..295 1566 100 Plus