RE56803.complete Sequence
577 bp (577 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071515
> RE56803.complete
AGTTAAAATCGAATCGAGATATTACCGGTGTTCTGCTGTTCGTCTTCTGT
TGTACAAATTCTATTTTTATAAATAGTTAACAATTAAATTAACAATTAAA
AATAACACTGGCATCCGCACCTAGCACCGTTACACGAAGAATTGAAGCGA
ATGGCGCGATCTAGCCTTTCAGAGAACCCGCGAACTAGAATGCGAACGAA
AAGTATAAGAACGAACTTCCAGTGCCTGGAAGGATGCCGACAAACGAAAT
TGGGCAATAGTGATGTGCGGAAATGAATCAATGGAGTTGCCATATCAACG
GTCCGGTGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTT
CTACCTACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGAC
ATCCTGGCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACA
GACACACGGCGCCCCAACATTTCCCACATTTTCAATAAAATGTAAACCAA
ACGATTCTCCGGATTCTTTCAATTCTTGTTCCGATTTGTATTCTTCATTC
ATTCCTTAAACAAAAAAAAAAAAAAAA
RE56803.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:42:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33181.o | 3682 | CG33181.o | 1..577 | 1..577 | 2840 | 99.4 | Plus |
CG33181-RF | 3176 | CG33181-RF | 1..577 | 1..577 | 2840 | 99.4 | Plus |
CG33181.e | 3542 | CG33181.e | 1..577 | 1..577 | 2840 | 99.4 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:21:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 8381134..8381422 | 1..289 | 1445 | 100 | Plus |
chrX | 22417052 | chrX | 8401228..8401500 | 289..561 | 1365 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 8489349..8489637 | 1..289 | 1445 | 100 | Plus |
X | 23542271 | X | 8509455..8509743 | 289..577 | 1400 | 99 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 8497447..8497735 | 1..289 | 1445 | 100 | Plus |
X | 23527363 | X | 8517553..8517841 | 289..577 | 1400 | 98.9 | Plus |
Blast to na_te.dros performed 2019-03-16 05:21:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
flea | 5034 | flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). | 202..262 | 50..109 | 122 | 68.9 | Plus |
flea | 5034 | flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). | 4961..5021 | 50..109 | 122 | 68.9 | Plus |
RE56803.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 05:22:39 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:41:31 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:28 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:45 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 2..562 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:44 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:28 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 2..562 | 1..561 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:39 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8489349..8489637 | 1..289 | 100 | -> | Plus |
X | 8509456..8509727 | 290..561 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:39 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8489349..8489637 | 1..289 | 100 | -> | Plus |
X | 8509456..8509727 | 290..561 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:39 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8489349..8489637 | 1..289 | 100 | -> | Plus |
X | 8509456..8509727 | 290..561 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:45 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 8383382..8383670 | 1..289 | 100 | -> | Plus |
arm_X | 8403489..8403760 | 290..561 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:45 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 8383382..8383670 | 1..289 | 100 | -> | Plus |
arm_X | 8403489..8403760 | 290..561 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:41 Download gff for
RE56803.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8497447..8497735 | 1..289 | 100 | -> | Plus |
X | 8517554..8517825 | 290..561 | 100 | | Plus |
RE56803.pep Sequence
Translation from 272 to 487
> RE56803.pep
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQ*
RE56803.pep Blast Records
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:01:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16905-PA | 69 | GD16905-PA | 1..69 | 3..71 | 334 | 97.1 | Plus |
RE56803.hyp Sequence
Translation from 272 to 487
> RE56803.hyp
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQ*
Sequence RE56803.hyp has no blast hits.