Clone RE56803 Report

Search the DGRC for RE56803

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:568
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG33181-RF
Protein status:RE56803.pep: validated full length
Preliminary Size:2877
Sequenced Size:577

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32714 2001-12-14 Blastp of sequenced clone
CG1521 2002-01-01 Sim4 clustering to Release 2
CG32714 2003-01-01 Sim4 clustering to Release 3
CG33181 2008-08-15 Release 5.9 accounting
CG33181 2008-12-18 5.12 accounting

Clone Sequence Records

RE56803.complete Sequence

577 bp (577 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071515

> RE56803.complete
AGTTAAAATCGAATCGAGATATTACCGGTGTTCTGCTGTTCGTCTTCTGT
TGTACAAATTCTATTTTTATAAATAGTTAACAATTAAATTAACAATTAAA
AATAACACTGGCATCCGCACCTAGCACCGTTACACGAAGAATTGAAGCGA
ATGGCGCGATCTAGCCTTTCAGAGAACCCGCGAACTAGAATGCGAACGAA
AAGTATAAGAACGAACTTCCAGTGCCTGGAAGGATGCCGACAAACGAAAT
TGGGCAATAGTGATGTGCGGAAATGAATCAATGGAGTTGCCATATCAACG
GTCCGGTGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTT
CTACCTACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGAC
ATCCTGGCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACA
GACACACGGCGCCCCAACATTTCCCACATTTTCAATAAAATGTAAACCAA
ACGATTCTCCGGATTCTTTCAATTCTTGTTCCGATTTGTATTCTTCATTC
ATTCCTTAAACAAAAAAAAAAAAAAAA

RE56803.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181.o 3682 CG33181.o 1..577 1..577 2840 99.4 Plus
CG33181-RF 3176 CG33181-RF 1..577 1..577 2840 99.4 Plus
CG33181.e 3542 CG33181.e 1..577 1..577 2840 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8381134..8381422 1..289 1445 100 Plus
chrX 22417052 chrX 8401228..8401500 289..561 1365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8489349..8489637 1..289 1445 100 Plus
X 23542271 X 8509455..8509743 289..577 1400 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8497447..8497735 1..289 1445 100 Plus
X 23527363 X 8517553..8517841 289..577 1400 98.9 Plus
Blast to na_te.dros performed 2019-03-16 05:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
flea 5034 flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). 202..262 50..109 122 68.9 Plus
flea 5034 flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). 4961..5021 50..109 122 68.9 Plus

RE56803.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 05:22:39 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:41:31 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:28 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:45 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 2..562 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:44 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:28 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 2..562 1..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:39 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
X 8489349..8489637 1..289 100 -> Plus
X 8509456..8509727 290..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:39 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
X 8489349..8489637 1..289 100 -> Plus
X 8509456..8509727 290..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:39 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
X 8489349..8489637 1..289 100 -> Plus
X 8509456..8509727 290..561 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:45 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383382..8383670 1..289 100 -> Plus
arm_X 8403489..8403760 290..561 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:45 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383382..8383670 1..289 100 -> Plus
arm_X 8403489..8403760 290..561 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:41 Download gff for RE56803.complete
Subject Subject Range Query Range Percent Splice Strand
X 8497447..8497735 1..289 100 -> Plus
X 8517554..8517825 290..561 100   Plus

RE56803.pep Sequence

Translation from 272 to 487

> RE56803.pep
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQ*

RE56803.pep Blast Records

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16905-PA 69 GD16905-PA 1..69 3..71 334 97.1 Plus

RE56803.hyp Sequence

Translation from 272 to 487

> RE56803.hyp
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQ*
Sequence RE56803.hyp has no blast hits.