Clone RE57126 Report

Search the DGRC for RE57126

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:571
Well:26
Vector:pFlc-1
Associated Gene/TranscriptCG3746-RA
Protein status:RE57126.pep: gold
Preliminary Size:557
Sequenced Size:581

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3746 2001-12-14 Blastp of sequenced clone
CG3746 2002-01-01 Sim4 clustering to Release 2
CG3746 2003-01-01 Sim4 clustering to Release 3
CG3746 2008-04-29 Release 5.5 accounting
CG3746 2008-08-15 Release 5.9 accounting
CG3746 2008-12-18 5.12 accounting

Clone Sequence Records

RE57126.complete Sequence

581 bp (581 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071522

> RE57126.complete
GTCAGTTACCATGGAGCAGCAGGTGGAGAGGTTACGGGTGAGATTGGTGC
CCGCCGGAACGGCGGAGGAACGTGCCAGGAATATTATTGCCAATGTGGTC
CTGGAGGATGGTCTGGTGCCCTTCATCGATGATCATGCGTCGGAGAAGGT
GACCCTGATCCCCCAGCAGTCAGCTGCTCCACTTTCCGCCGCCCAACAGG
AACCATCCATCCGGTACTACGCCGTTGGGCCCTCCACCTACAAGCTGTTG
TGTCCACTGTGCCGCGAGAGGAGTGAGGCGGCTGTGATGAGAGCAGCCAG
CTGCAAGGACGCCAGTTTCTGCCTCAGCCTGCTATCCTGCATCTTTCCGC
TCTTCTGGATCTGCTGCGTGTGCACCTGGTGCGGTTGCAATCGGGAGTGG
ACCACCAAGGGCGTTTACTGCAGCTCGTGTGGCGGCAAAGTGGGAATCCA
GCGCAAGGCCAAGTAGCCCATCCCGCGGACCAATTAAATCGAAATTAATG
CCAAATATTTATCTGTTCTATAATTCTATTACGCGTCTAACTCAATTAAA
GACACACTGTAAATCAAAAAAAAAAAAAAAA

RE57126.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3746-RA 747 CG3746-RA 70..636 1..567 2835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18535974..18536312 339..1 1695 100 Minus
chr2R 21145070 chr2R 18535684..18535914 565..335 1140 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22649408..22649746 339..1 1695 100 Minus
2R 25286936 2R 22649116..22649348 567..335 1150 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22650607..22650945 339..1 1695 100 Minus
2R 25260384 2R 22650315..22650547 567..335 1150 99.5 Minus
Blast to na_te.dros performed on 2019-03-15 22:47:55 has no hits.

RE57126.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:48:40 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18535684..18535909 340..565 100 <- Minus
chr2R 18535974..18536312 1..339 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:24 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..456 11..466 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:39 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..456 11..466 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:52 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..456 11..466 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:50 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..456 11..466 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:24 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..456 11..466 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:24 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..565 1..565 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:39 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..565 1..565 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:52 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 5..569 1..565 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:50 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 1..565 1..565 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:24 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
CG3746-RA 5..569 1..565 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:48:40 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22649408..22649746 1..339 100   Minus
2R 22649118..22649343 340..565 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:48:40 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22649408..22649746 1..339 100   Minus
2R 22649118..22649343 340..565 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:48:40 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22649408..22649746 1..339 100   Minus
2R 22649118..22649343 340..565 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:52 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18536623..18536848 340..565 100 <- Minus
arm_2R 18536913..18537251 1..339 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:22 Download gff for RE57126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22650317..22650542 340..565 100 <- Minus
2R 22650607..22650945 1..339 100   Minus

RE57126.hyp Sequence

Translation from 0 to 465

> RE57126.hyp
SVTMEQQVERLRVRLVPAGTAEERARNIIANVVLEDGLVPFIDDHASEKV
TLIPQQSAAPLSAAQQEPSIRYYAVGPSTYKLLCPLCRERSEAAVMRAAS
CKDASFCLSLLSCIFPLFWICCVCTWCGCNREWTTKGVYCSSCGGKVGIQ
RKAK*

RE57126.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3746-PB 151 CG3746-PB 1..151 4..154 806 100 Plus
CG3746-PA 151 CG3746-PA 1..151 4..154 806 100 Plus
CG43326-PB 123 CG43326-PB 23..117 56..148 155 35.1 Plus
CG43326-PA 123 CG30217-PB 23..117 56..148 155 35.1 Plus

RE57126.pep Sequence

Translation from 10 to 465

> RE57126.pep
MEQQVERLRVRLVPAGTAEERARNIIANVVLEDGLVPFIDDHASEKVTLI
PQQSAAPLSAAQQEPSIRYYAVGPSTYKLLCPLCRERSEAAVMRAASCKD
ASFCLSLLSCIFPLFWICCVCTWCGCNREWTTKGVYCSSCGGKVGIQRKA
K*

RE57126.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13579-PA 150 GF13579-PA 1..150 1..151 696 86.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21772-PA 151 GG21772-PA 1..151 1..151 761 94 Plus
Dere\GG21769-PA 271 GG21769-PA 185..267 64..147 140 34.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22104-PA 153 GH22104-PA 2..152 4..150 521 66.9 Plus
Dgri\GH22101-PA 274 GH22101-PA 186..270 62..147 181 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3746-PB 151 CG3746-PB 1..151 1..151 806 100 Plus
CG3746-PA 151 CG3746-PA 1..151 1..151 806 100 Plus
CG43326-PB 123 CG43326-PB 23..117 53..145 155 35.1 Plus
CG43326-PA 123 CG30217-PB 23..117 53..145 155 35.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19239-PA 152 GI19239-PA 1..151 1..150 489 66.2 Plus
Dmoj\GI19236-PA 275 GI19236-PA 189..271 64..147 182 48.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10716-PA 155 GL10716-PA 4..155 2..151 581 75.2 Plus
Dper\GL10713-PA 283 GL10713-PA 197..279 64..147 144 36.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17657-PA 155 GA17657-PA 4..155 2..151 605 79.1 Plus
Dpse\GA15726-PA 283 GA15726-PA 197..279 64..147 144 36.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15622-PA 151 GM15622-PA 1..151 1..151 769 96 Plus
Dsec\GM15617-PA 271 GM15617-PA 171..267 53..147 145 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25114-PA 178 GD25114-PA 1..177 1..151 550 67.2 Plus
Dsim\GD25111-PA 271 GD25111-PA 185..267 64..147 143 35.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20314-PA 152 GJ20314-PA 2..151 4..150 549 69.9 Plus
Dvir\GJ20311-PA 278 GJ20311-PA 192..274 64..147 176 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21852-PA 161 GK21852-PA 1..161 1..151 553 67.3 Plus
Dwil\GK21849-PA 269 GK21849-PA 163..265 39..147 179 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11848-PA 151 GE11848-PA 1..151 1..151 749 93.4 Plus
Dyak\GE11844-PA 271 GE11844-PA 185..267 64..147 140 35.3 Plus