Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
RE57135.complete Sequence
902 bp (902 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071524
> RE57135.complete
AAAAAAACAGGTGACGAAACACATGCTTGTCCTGCGCCGGCTTGTTTATC
CGGGAGTAGCCAGGATTCCAGCGGATGTCTGGGCCCGCAGCCACGCCCTG
GTGGAGTTTCCCGGCCAGTGGCCTCGCTGTGAGCAGCACCAGTTTGAATC
GGACATGCGGGTCATCAGGGACTTCATCACTGCGAAGGAGGAGCAACTAC
TGATGCGGGAAATCGAGCCTCACATCAGCCGCTTGCCGTACGAGTTGAGC
CACTGTGATGACGTGGGCAGATACCGCGAAGTTGAACGCCGAAAGTGGAC
TCCCCAAAACCAGGCCACGCTGGATCACGTCTCGTGAGTTTCCTTCGGTG
AGCAGGTCATGCCCTTCGTGCACATCCTGGACTTGGCTGACTCTGGCGCG
ATCAAGCCGCACGTGGACAACACTCGATTTTGCGGCAACACCACTGCGGG
CATTAGCATGCTCAGCGACTGAAGCGCGTGACCAAGGATCCCATGACTTT
GTCAGCCACTCTGAGGATCTGCTCCTGCCGCAACTCTCGCTCTATATTAA
GAGTGCCCTAGCGCGATACGAGTTCACCCACGAAATCCTGGCCAGAGATC
AGTCGTGGTTCAAGGAGCGCTTGGTCGAAACGAACCTTGATGGCATACGC
ATAGTTTCCTTTTCTCACAGCTGGTGTACATGTATATATATATATATATA
CAATGAAAATTTATTCCGGTTTGGTGATCAGCTAATGTAATACAGACGGC
GGACTGCGACGGATTACACGACGTGATTCAGCCATGTAATATATGATACA
CTAAATCAAATGTACATATACATAGTATATCTTAAGCTAGCTACTTGTAC
TTTATAAATATTGGGCTCACCTTTCTCACTCGCTTCAAAAAAAAAAAAAA
AA
RE57135.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:45:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14798-RA | 911 | CG14798-RA | 28..911 | 3..886 | 4420 | 100 | Plus |
CG14798.a | 882 | CG14798.a | 3..882 | 3..886 | 4335 | 99.5 | Plus |
a6-RA | 2296 | a6-RA | 2065..2296 | 889..658 | 1160 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:24:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 1587231..1587689 | 428..886 | 2295 | 100 | Plus |
chrX | 22417052 | chrX | 1586684..1586948 | 3..267 | 1265 | 98.5 | Plus |
chrX | 22417052 | chrX | 1587012..1587169 | 270..427 | 745 | 98.1 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 1693385..1693846 | 428..889 | 2310 | 100 | Plus |
X | 23542271 | X | 1692838..1693102 | 3..267 | 1325 | 100 | Plus |
X | 23542271 | X | 1693162..1693323 | 266..427 | 810 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 1701483..1701944 | 428..889 | 2310 | 100 | Plus |
X | 23527363 | X | 1700936..1701200 | 3..267 | 1325 | 100 | Plus |
X | 23527363 | X | 1701260..1701421 | 266..427 | 810 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 05:24:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 1693..1741 | 870..822 | 110 | 69.4 | Minus |
RE57135.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:24:50 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 1586682..1586951 | 1..270 | 97 | -> | Plus |
chrX | 1587013..1587169 | 271..427 | 98 | -> | Plus |
chrX | 1587231..1587689 | 428..886 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:26 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 1..483 | 258..740 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:29 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 1..483 | 258..740 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:58 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 1..483 | 258..740 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:40 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 1..483 | 258..740 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:02:25 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 1..483 | 258..740 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:11 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 3..886 | 3..886 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:29 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 3..886 | 3..886 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:58 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 13..898 | 1..886 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:40 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 3..886 | 3..886 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:02:25 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14798-RA | 13..898 | 1..886 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:50 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1692836..1693101 | 1..266 | 99 | -> | Plus |
X | 1693163..1693323 | 267..427 | 100 | -> | Plus |
X | 1693385..1693843 | 428..886 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:50 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1692836..1693101 | 1..266 | 99 | -> | Plus |
X | 1693163..1693323 | 267..427 | 100 | -> | Plus |
X | 1693385..1693843 | 428..886 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:50 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1692836..1693101 | 1..266 | 99 | -> | Plus |
X | 1693163..1693323 | 267..427 | 100 | -> | Plus |
X | 1693385..1693843 | 428..886 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:58 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 1586869..1587134 | 1..266 | 99 | -> | Plus |
arm_X | 1587196..1587356 | 267..427 | 100 | -> | Plus |
arm_X | 1587418..1587876 | 428..886 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:10 Download gff for
RE57135.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1700934..1701199 | 1..266 | 99 | -> | Plus |
X | 1701261..1701421 | 267..427 | 100 | -> | Plus |
X | 1701483..1701941 | 428..886 | 100 | | Plus |
RE57135.pep Sequence
Translation from 257 to 739
> RE57135.pep
MTWADTAKLNAESGLPKTRPRWITSREFPSVSRSCPSCTSWTWLTLARSS
RTWTTLDFAATPLRALACSATEARDQGSHDFVSHSEDLLLPQLSLYIKSA
LARYEFTHEILARDQSWFKERLVETNLDGIRIVSFSHSWCTCIYIYIYNE
NLFRFGDQLM*
RE57135.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:19:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12876-PA | 219 | GG12876-PA | 162..206 | 80..124 | 190 | 84.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14798-PA | 160 | CG14798-PA | 1..160 | 1..160 | 858 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:19:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19489-PA | 160 | GM19489-PA | 1..148 | 9..160 | 463 | 61.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:19:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24723-PA | 195 | GD24723-PA | 71..182 | 5..124 | 456 | 77.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:19:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16706-PA | 121 | GE16706-PA | 64..108 | 80..124 | 198 | 86.7 | Plus |
RE57135.hyp Sequence
Translation from 257 to 739
> RE57135.hyp
MTWADTAKLNAESGLPKTRPRWITSREFPSVSRSCPSCTSWTWLTLARSS
RTWTTLDFAATPLRALACSATEARDQGSHDFVSHSEDLLLPQLSLYIKSA
LARYEFTHEILARDQSWFKERLVETNLDGIRIVSFSHSWCTCIYIYIYNE
NLFRFGDQLM*
RE57135.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14798-PA | 160 | CG14798-PA | 1..160 | 1..160 | 858 | 100 | Plus |