Clone RE57135 Report

Search the DGRC for RE57135

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:571
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG14798-RA
Protein status:RE57135.pep: gold
Preliminary Size:315
Sequenced Size:902

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14798 2001-12-14 Blastp of sequenced clone
CG14798 2002-01-01 Sim4 clustering to Release 2
CG14798 2003-01-01 Sim4 clustering to Release 3
CG14798 2008-04-29 Release 5.5 accounting
CG14798 2008-08-15 Release 5.9 accounting
CG14798 2008-12-18 5.12 accounting

Clone Sequence Records

RE57135.complete Sequence

902 bp (902 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071524

> RE57135.complete
AAAAAAACAGGTGACGAAACACATGCTTGTCCTGCGCCGGCTTGTTTATC
CGGGAGTAGCCAGGATTCCAGCGGATGTCTGGGCCCGCAGCCACGCCCTG
GTGGAGTTTCCCGGCCAGTGGCCTCGCTGTGAGCAGCACCAGTTTGAATC
GGACATGCGGGTCATCAGGGACTTCATCACTGCGAAGGAGGAGCAACTAC
TGATGCGGGAAATCGAGCCTCACATCAGCCGCTTGCCGTACGAGTTGAGC
CACTGTGATGACGTGGGCAGATACCGCGAAGTTGAACGCCGAAAGTGGAC
TCCCCAAAACCAGGCCACGCTGGATCACGTCTCGTGAGTTTCCTTCGGTG
AGCAGGTCATGCCCTTCGTGCACATCCTGGACTTGGCTGACTCTGGCGCG
ATCAAGCCGCACGTGGACAACACTCGATTTTGCGGCAACACCACTGCGGG
CATTAGCATGCTCAGCGACTGAAGCGCGTGACCAAGGATCCCATGACTTT
GTCAGCCACTCTGAGGATCTGCTCCTGCCGCAACTCTCGCTCTATATTAA
GAGTGCCCTAGCGCGATACGAGTTCACCCACGAAATCCTGGCCAGAGATC
AGTCGTGGTTCAAGGAGCGCTTGGTCGAAACGAACCTTGATGGCATACGC
ATAGTTTCCTTTTCTCACAGCTGGTGTACATGTATATATATATATATATA
CAATGAAAATTTATTCCGGTTTGGTGATCAGCTAATGTAATACAGACGGC
GGACTGCGACGGATTACACGACGTGATTCAGCCATGTAATATATGATACA
CTAAATCAAATGTACATATACATAGTATATCTTAAGCTAGCTACTTGTAC
TTTATAAATATTGGGCTCACCTTTCTCACTCGCTTCAAAAAAAAAAAAAA
AA

RE57135.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14798-RA 911 CG14798-RA 28..911 3..886 4420 100 Plus
CG14798.a 882 CG14798.a 3..882 3..886 4335 99.5 Plus
a6-RA 2296 a6-RA 2065..2296 889..658 1160 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1587231..1587689 428..886 2295 100 Plus
chrX 22417052 chrX 1586684..1586948 3..267 1265 98.5 Plus
chrX 22417052 chrX 1587012..1587169 270..427 745 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1693385..1693846 428..889 2310 100 Plus
X 23542271 X 1692838..1693102 3..267 1325 100 Plus
X 23542271 X 1693162..1693323 266..427 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1701483..1701944 428..889 2310 100 Plus
X 23527363 X 1700936..1701200 3..267 1325 100 Plus
X 23527363 X 1701260..1701421 266..427 810 100 Plus
Blast to na_te.dros performed 2019-03-16 05:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1693..1741 870..822 110 69.4 Minus

RE57135.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:24:50 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1586682..1586951 1..270 97 -> Plus
chrX 1587013..1587169 271..427 98 -> Plus
chrX 1587231..1587689 428..886 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:26 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 1..483 258..740 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:29 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 1..483 258..740 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:58 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 1..483 258..740 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:40 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 1..483 258..740 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:02:25 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 1..483 258..740 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:11 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 3..886 3..886 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:29 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 3..886 3..886 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:58 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 13..898 1..886 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:40 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 3..886 3..886 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:02:25 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
CG14798-RA 13..898 1..886 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:50 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
X 1692836..1693101 1..266 99 -> Plus
X 1693163..1693323 267..427 100 -> Plus
X 1693385..1693843 428..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:50 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
X 1692836..1693101 1..266 99 -> Plus
X 1693163..1693323 267..427 100 -> Plus
X 1693385..1693843 428..886 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:50 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
X 1692836..1693101 1..266 99 -> Plus
X 1693163..1693323 267..427 100 -> Plus
X 1693385..1693843 428..886 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:58 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1586869..1587134 1..266 99 -> Plus
arm_X 1587196..1587356 267..427 100 -> Plus
arm_X 1587418..1587876 428..886 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:10 Download gff for RE57135.complete
Subject Subject Range Query Range Percent Splice Strand
X 1700934..1701199 1..266 99 -> Plus
X 1701261..1701421 267..427 100 -> Plus
X 1701483..1701941 428..886 100   Plus

RE57135.pep Sequence

Translation from 257 to 739

> RE57135.pep
MTWADTAKLNAESGLPKTRPRWITSREFPSVSRSCPSCTSWTWLTLARSS
RTWTTLDFAATPLRALACSATEARDQGSHDFVSHSEDLLLPQLSLYIKSA
LARYEFTHEILARDQSWFKERLVETNLDGIRIVSFSHSWCTCIYIYIYNE
NLFRFGDQLM*

RE57135.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12876-PA 219 GG12876-PA 162..206 80..124 190 84.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14798-PA 160 CG14798-PA 1..160 1..160 858 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19489-PA 160 GM19489-PA 1..148 9..160 463 61.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24723-PA 195 GD24723-PA 71..182 5..124 456 77.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16706-PA 121 GE16706-PA 64..108 80..124 198 86.7 Plus

RE57135.hyp Sequence

Translation from 257 to 739

> RE57135.hyp
MTWADTAKLNAESGLPKTRPRWITSREFPSVSRSCPSCTSWTWLTLARSS
RTWTTLDFAATPLRALACSATEARDQGSHDFVSHSEDLLLPQLSLYIKSA
LARYEFTHEILARDQSWFKERLVETNLDGIRIVSFSHSWCTCIYIYIYNE
NLFRFGDQLM*

RE57135.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14798-PA 160 CG14798-PA 1..160 1..160 858 100 Plus