Clone RE57173 Report

Search the DGRC for RE57173

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:571
Well:73
Vector:pFlc-1
Associated Gene/TranscriptCG31278-RA
Protein status:RE57173.pep: gold
Sequenced Size:878

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31278 2003-01-01 Sim4 clustering to Release 3
CG31278 2004-10-22 Blastp of sequenced clone
CG31278 2008-04-29 Release 5.5 accounting
CG31278 2008-08-15 Release 5.9 accounting
CG31278 2008-12-18 5.12 accounting

Clone Sequence Records

RE57173.complete Sequence

878 bp (878 high quality bases) assembled on 2004-10-22

GenBank Submission: BT015988

> RE57173.complete
GTTGTGTAACTATATTCCCTACGATTTTGATCGGAATATTAAAGGAGGCT
AAACATTTCACAAAATGCACCTGAAACCACGGATAAAAGTATGCCAAGCG
ATTCTGGGACATTGTCGATCCTTTGGAACGAGTCCTCCCGCTAATCAGTC
GTTCAGGAAGTGGTACCAGCACCTGTGGACCACGGAGCGCACAAACTTGC
CGCCATACAACCATTTCACCCAGATTGGTGACCCTGTTCTTAGGCAACAA
GCGGCTTTGGTGCCCAAGGAGCACATGGCTAGCCCCGAGATTAAGGCCAT
CGTCGAGCGGATGGTCAAGGTGCTAAGGAAGTTCGACTGCGTCGGCATTG
CGGCTCCTCAGATTGGAGTATCGCTCAGGATCATAGCAATGGAGTTCAAG
GGACGGATCCGAAAGGAGCTGCCCGAGGCCGTTTACCAAGCCCGACAAAT
GTCCGAGTTGCCACTGACTATTTTCATCAATCCCGTCCTGACGGTGACCA
ACTACGCGAAGCTGAAGCATCCAGAAGGATGCATGAGTGTGCGAGGTTAC
TCTGCCGAAGTGGAGCGTTTCGAAGGTGTAAAGCTAACAGGCCTTGACCA
ACTAGGAAACCAAAGCGAACTGGCTCTGAGTGGTTGGAATGCCCGGATAG
CGCAGCACGAAATGGATCACCTGGAGGGAAAACTATACACCGATCACATG
GACCGCTCAACCTTTGCGTGCACCTGCTGGGAGGCGGTTAACACGAAATC
CGGACGCGTGGAGATACCCTTCTACAAGTAGTTAAGTCGCTCGTGGATCG
TTTCACTATTTATGTATGTATATATACTGATTGAATGGAATTCTATCTGG
CAAATGTTAAAGAAAAAAAAAAAAAAAA

RE57173.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG31278-RA 951 CG31278-RA 14..871 1..858 4290 100 Plus
nc_15893.a 366 nc_15893.a 81..366 470..755 1430 100 Plus
nc_15893.a 366 nc_15893.a 1..80 9..88 400 100 Plus
CG14684-RA 487 CG14684-RA 425..487 858..796 315 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6533402..6533870 469..1 2345 100 Minus
chr3R 27901430 chr3R 6532942..6533330 858..470 1945 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10707858..10708326 469..1 2345 100 Minus
3R 32079331 3R 10707398..10707786 858..470 1945 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10448689..10449157 469..1 2345 100 Minus
3R 31820162 3R 10448229..10448617 858..470 1945 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:40:51 has no hits.

RE57173.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:41:54 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6532938..6533330 470..862 98 <- Minus
chr3R 6533402..6533870 1..469 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:29 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..717 65..781 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:29:55 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..717 65..781 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:56:10 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..717 65..781 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:13:50 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..717 65..781 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:54 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..717 65..781 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:34:06 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:29:55 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:56:10 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 15..872 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:13:50 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:54 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
CG31278-RA 15..872 1..858 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:54 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10707394..10707786 470..862 98 <- Minus
3R 10707858..10708326 1..469 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:54 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10707394..10707786 470..862 98 <- Minus
3R 10707858..10708326 1..469 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:54 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10707394..10707786 470..862 98 <- Minus
3R 10707858..10708326 1..469 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:56:10 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6533116..6533508 470..862 98 <- Minus
arm_3R 6533580..6534048 1..469 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:50:34 Download gff for RE57173.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10448225..10448617 470..862 98 <- Minus
3R 10448689..10449157 1..469 100   Minus

RE57173.pep Sequence

Translation from 64 to 780

> RE57173.pep
MHLKPRIKVCQAILGHCRSFGTSPPANQSFRKWYQHLWTTERTNLPPYNH
FTQIGDPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQI
GVSLRIIAMEFKGRIRKELPEAVYQARQMSELPLTIFINPVLTVTNYAKL
KHPEGCMSVRGYSAEVERFEGVKLTGLDQLGNQSELALSGWNARIAQHEM
DHLEGKLYTDHMDRSTFACTCWEAVNTKSGRVEIPFYK*

RE57173.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17444-PA 238 GF17444-PA 4..238 4..238 1044 80 Plus
Dana\GF17443-PA 196 GF17443-PA 4..196 46..238 623 59.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17276-PA 238 GG17276-PA 1..238 1..238 1195 92 Plus
Dere\GG17275-PA 196 GG17275-PA 4..196 46..238 600 56 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17361-PA 234 GH17361-PA 12..234 16..238 942 78 Plus
Dgri\GH17360-PA 203 GH17360-PA 11..203 46..238 616 59.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31278-PA 238 CG31278-PA 1..238 1..238 1264 100 Plus
CG31278-PB 145 CG31278-PB 1..136 1..136 714 99.3 Plus
CG31373-PA 196 CG31373-PA 4..196 46..238 602 58 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23900-PA 234 GI23900-PA 12..234 16..238 972 79.4 Plus
Dmoj\GI23899-PA 203 GI23899-PA 11..203 46..238 584 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12633-PA 238 GL12633-PA 1..238 1..238 1030 78.6 Plus
Dper\GL12632-PA 196 GL12632-PA 2..196 44..238 634 59.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16144-PA 238 GA16144-PA 1..238 1..238 1024 78.2 Plus
Dpse\GA16218-PA 196 GA16218-PA 2..196 44..238 631 59 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26160-PA 238 GM26160-PA 1..238 1..238 1249 96.2 Plus
Dsec\GM26159-PA 196 GM26159-PA 4..196 46..238 616 57.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20713-PA 239 GD20713-PA 1..226 1..226 1167 94.7 Plus
Dsim\GD20712-PA 196 GD20712-PA 4..196 46..238 610 57 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23993-PA 234 GJ23993-PA 12..234 16..238 950 76.7 Plus
Dvir\GJ23992-PA 203 GJ23992-PA 5..203 39..238 603 56.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11287-PA 241 GK11287-PA 18..241 15..238 990 79.5 Plus
Dwil\GK11285-PA 173 GK11285-PA 2..168 44..210 518 57.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24678-PA 238 GE24678-PA 1..238 1..238 1202 92 Plus
Dyak\GE24677-PA 196 GE24677-PA 4..196 46..238 615 58 Plus

RE57173.hyp Sequence

Translation from 64 to 780

> RE57173.hyp
MHLKPRIKVCQAILGHCRSFGTSPPANQSFRKWYQHLWTTERTNLPPYNH
FTQIGDPVLRQQAALVPKEHMASPEIKAIVERMVKVLRKFDCVGIAAPQI
GVSLRIIAMEFKGRIRKELPEAVYQARQMSELPLTIFINPVLTVTNYAKL
KHPEGCMSVRGYSAEVERFEGVKLTGLDQLGNQSELALSGWNARIAQHEM
DHLEGKLYTDHMDRSTFACTCWEAVNTKSGRVEIPFYK*

RE57173.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31278-PA 238 CG31278-PA 1..238 1..238 1264 100 Plus
CG31278-PB 145 CG31278-PB 1..136 1..136 714 99.3 Plus
CG31373-PA 196 CG31373-PA 4..196 46..238 602 58 Plus