Clone RE57333 Report

Search the DGRC for RE57333

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:573
Well:33
Vector:pFlc-1
Associated Gene/TranscriptRpS4-RA
Protein status:RE57333.pep: gold
Sequenced Size:992

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11276 2003-01-01 Sim4 clustering to Release 3
CG11276 2004-01-09 Blastp of sequenced clone
RpS4 2008-04-29 Release 5.5 accounting
RpS4 2008-08-15 Release 5.9 accounting
RpS4 2008-12-18 5.12 accounting

Clone Sequence Records

RE57333.complete Sequence

992 bp (992 high quality bases) assembled on 2004-01-09

GenBank Submission: BT011369

> RE57333.complete
AGTTATTCGACGCCAACTGCCCGCTGGCCACACCGCCCGCAAATCTGCCT
TTTCCTTTTCCTGTTGTATTGCCCGACGGACGTGATCGCCCGTTCAATAT
AGTGAATCAAACATGGCTCGTGGCCCCAAGAAGCATTTGAAGCGTTTAGC
CGCCCCCAAGGCATGGATGTTGGACAAGCTGGGAGGCGTCTTCGCCCCGC
GTCCCTCGACCGGTCCACACAAGCTCCGTGAGTCGCTGCCCCTGCTGATC
TTCTTGAGAAACCGCTTGAAGTACGCCCTCAATGGCGCCGAGGTCACCAA
GATCGTCATGCAGCGCCTGGTTAAGGTCGATGGAAAGGTCCGCACCGACC
CCACCTATCCCGCTGGCTACATGGATGTCATCACCCTCGAGAAGACCGGT
GAGTTCTTCCGTCTGGTCTACGACGTGAAGGGACGCTTCGTCATCCACCG
CATCTCCGCCGAGGAGGCCAAGTACAAGTTGTGCAAGGTCAAGAAGACCC
AGCTGGGAGCCAAGGGAGTTCCTTTCCTGGTTACACACGACGGTCGCACC
ATCCGCTACCCGGATCCCCTGATCCACGCCAACGATTCCGTGCAGGTGGA
CATTGCCTCTGGCAAGATCACCGACTACATTAAGTTCGATTCTGGCAACC
TCTGCATGATCACCGGAGGCAGGAATTTGGGACGTGTCGGCACCGTTGTC
AACCGTGAGCGTCATCCCGGTTCCTTCGACATTGTGCACATTAAGGACTC
GCAAGGTCATGTGTTCGCCACCCGTTTGACCAACGTGTTCATCATTGGCA
AGGGCAACAAGCCCTACATCTCCCTGCCTAAGGGCAAGGGTGTCAAGCTG
AGCATTGCGGAGGAGCGCGACAAGCGTCTGGCCGCCAAGACCCACTAAGG
CGCAGGAGTTTAAGGACTTTTACCTTTTAGCATAACACTCTGTACGTTTA
GCTACGGAATTACAAGCCGAGAACGTAAAAAAAAAAAAAAAA

RE57333.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpS4-RA 1505 RpS4-RA 113..1090 1..978 4890 100 Plus
RpS4-RB 1327 RpS4-RB 338..1234 82..978 4485 100 Plus
RpS4.b 1551 RpS4.b 338..1234 82..978 4485 100 Plus
RpS4-RB 1327 RpS4-RB 113..194 1..82 410 100 Plus
RpS4.b 1551 RpS4.b 113..194 1..82 410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13033874..13034206 644..976 1665 100 Plus
chr3L 24539361 chr3L 13032410..13032669 115..374 1300 100 Plus
chr3L 24539361 chr3L 13033465..13033639 471..645 875 100 Plus
chr3L 24539361 chr3L 13032742..13032840 374..472 495 100 Plus
chr3L 24539361 chr3L 13032057..13032138 1..82 410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13043573..13043907 644..978 1675 100 Plus
3L 28110227 3L 13042109..13042368 115..374 1300 100 Plus
3L 28110227 3L 13043164..13043338 471..645 875 100 Plus
3L 28110227 3L 13042441..13042539 374..472 495 100 Plus
3L 28110227 3L 13041756..13041837 1..82 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13036673..13037007 644..978 1675 100 Plus
3L 28103327 3L 13035209..13035468 115..374 1300 100 Plus
3L 28103327 3L 13036264..13036438 471..645 875 100 Plus
3L 28103327 3L 13035541..13035639 374..472 495 100 Plus
3L 28103327 3L 13034856..13034937 1..82 410 100 Plus
3L 28103327 3L 13035081..13035115 82..116 175 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:42:34 has no hits.

RE57333.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:43:33 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13032057..13032138 1..82 100 -> Plus
chr3L 13032283..13032315 83..115 100 -> Plus
chr3L 13032411..13032669 116..374 100 -> Plus
chr3L 13032743..13032840 375..472 100 -> Plus
chr3L 13033467..13033638 473..644 100 -> Plus
chr3L 13033875..13034206 645..976 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:34 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RB 1..786 113..898 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:43:32 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RB 1..786 113..898 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:56:24 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..786 113..898 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:32:22 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RB 1..786 113..898 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:47:12 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..786 113..898 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:53:48 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:43:32 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:56:24 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:32:22 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:47:12 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
RpS4-RA 1..976 1..976 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:43:33 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13043574..13043905 645..976 100   Plus
3L 13041756..13041837 1..82 100 -> Plus
3L 13041982..13042014 83..115 100 -> Plus
3L 13042110..13042368 116..374 100 -> Plus
3L 13042442..13042539 375..472 100 -> Plus
3L 13043166..13043337 473..644 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:43:33 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13043574..13043905 645..976 100   Plus
3L 13041756..13041837 1..82 100 -> Plus
3L 13041982..13042014 83..115 100 -> Plus
3L 13042110..13042368 116..374 100 -> Plus
3L 13042442..13042539 375..472 100 -> Plus
3L 13043166..13043337 473..644 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:43:33 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13043574..13043905 645..976 100   Plus
3L 13041756..13041837 1..82 100 -> Plus
3L 13041982..13042014 83..115 100 -> Plus
3L 13042110..13042368 116..374 100 -> Plus
3L 13042442..13042539 375..472 100 -> Plus
3L 13043166..13043337 473..644 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:56:24 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13036266..13036437 473..644 100 -> Plus
arm_3L 13036674..13037005 645..976 100   Plus
arm_3L 13034856..13034937 1..82 100 -> Plus
arm_3L 13035082..13035114 83..115 100 -> Plus
arm_3L 13035210..13035468 116..374 100 -> Plus
arm_3L 13035542..13035639 375..472 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:04:59 Download gff for RE57333.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13035210..13035468 116..374 100 -> Plus
3L 13035542..13035639 375..472 100 -> Plus
3L 13036266..13036437 473..644 100 -> Plus
3L 13036674..13037005 645..976 100   Plus
3L 13034856..13034937 1..82 100 -> Plus
3L 13035082..13035114 83..115 100 -> Plus

RE57333.pep Sequence

Translation from 112 to 897

> RE57333.pep
MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRN
RLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFR
LVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYP
DPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRER
HPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAE
ERDKRLAAKTH*

RE57333.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24027-PA 261 GF24027-PA 1..261 1..261 1357 98.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15623-PA 261 GG15623-PA 1..261 1..261 1367 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17143-PA 261 GH17143-PA 1..261 1..261 1345 96.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpS4-PC 261 CG11276-PC 1..261 1..261 1356 100 Plus
RpS4-PB 261 CG11276-PB 1..261 1..261 1356 100 Plus
RpS4-PA 261 CG11276-PA 1..261 1..261 1356 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11752-PA 261 GI11752-PA 1..261 1..261 1344 96.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25330-PA 261 GL25330-PA 1..261 1..261 1341 96.9 Plus
Dper\GL26779-PA 135 GL26779-PA 1..128 90..254 186 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10883-PA 261 GA10883-PA 1..261 1..261 1341 96.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25394-PA 261 GM25394-PA 1..261 1..261 1370 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14426-PA 261 GD14426-PA 1..261 1..261 1370 100 Plus
Dsim\GD17639-PA 145 GD17639-PA 1..126 1..124 629 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13462-PA 261 GJ13462-PA 1..261 1..261 1346 96.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17425-PA 261 GK17425-PA 1..261 1..261 1353 98.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS4-PA 261 GE21948-PA 1..261 1..261 1365 99.2 Plus

RE57333.hyp Sequence

Translation from 112 to 897

> RE57333.hyp
MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRN
RLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFR
LVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYP
DPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRER
HPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAE
ERDKRLAAKTH*

RE57333.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
RpS4-PC 261 CG11276-PC 1..261 1..261 1356 100 Plus
RpS4-PB 261 CG11276-PB 1..261 1..261 1356 100 Plus
RpS4-PA 261 CG11276-PA 1..261 1..261 1356 100 Plus