BDGP Sequence Production Resources |
Search the DGRC for RE57333
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 573 |
Well: | 33 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS4-RA |
Protein status: | RE57333.pep: gold |
Sequenced Size: | 992 |
Gene | Date | Evidence |
---|---|---|
CG11276 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11276 | 2004-01-09 | Blastp of sequenced clone |
RpS4 | 2008-04-29 | Release 5.5 accounting |
RpS4 | 2008-08-15 | Release 5.9 accounting |
RpS4 | 2008-12-18 | 5.12 accounting |
992 bp (992 high quality bases) assembled on 2004-01-09
GenBank Submission: BT011369
> RE57333.complete AGTTATTCGACGCCAACTGCCCGCTGGCCACACCGCCCGCAAATCTGCCT TTTCCTTTTCCTGTTGTATTGCCCGACGGACGTGATCGCCCGTTCAATAT AGTGAATCAAACATGGCTCGTGGCCCCAAGAAGCATTTGAAGCGTTTAGC CGCCCCCAAGGCATGGATGTTGGACAAGCTGGGAGGCGTCTTCGCCCCGC GTCCCTCGACCGGTCCACACAAGCTCCGTGAGTCGCTGCCCCTGCTGATC TTCTTGAGAAACCGCTTGAAGTACGCCCTCAATGGCGCCGAGGTCACCAA GATCGTCATGCAGCGCCTGGTTAAGGTCGATGGAAAGGTCCGCACCGACC CCACCTATCCCGCTGGCTACATGGATGTCATCACCCTCGAGAAGACCGGT GAGTTCTTCCGTCTGGTCTACGACGTGAAGGGACGCTTCGTCATCCACCG CATCTCCGCCGAGGAGGCCAAGTACAAGTTGTGCAAGGTCAAGAAGACCC AGCTGGGAGCCAAGGGAGTTCCTTTCCTGGTTACACACGACGGTCGCACC ATCCGCTACCCGGATCCCCTGATCCACGCCAACGATTCCGTGCAGGTGGA CATTGCCTCTGGCAAGATCACCGACTACATTAAGTTCGATTCTGGCAACC TCTGCATGATCACCGGAGGCAGGAATTTGGGACGTGTCGGCACCGTTGTC AACCGTGAGCGTCATCCCGGTTCCTTCGACATTGTGCACATTAAGGACTC GCAAGGTCATGTGTTCGCCACCCGTTTGACCAACGTGTTCATCATTGGCA AGGGCAACAAGCCCTACATCTCCCTGCCTAAGGGCAAGGGTGTCAAGCTG AGCATTGCGGAGGAGCGCGACAAGCGTCTGGCCGCCAAGACCCACTAAGG CGCAGGAGTTTAAGGACTTTTACCTTTTAGCATAACACTCTGTACGTTTA GCTACGGAATTACAAGCCGAGAACGTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS4-RA | 1505 | RpS4-RA | 113..1090 | 1..978 | 4890 | 100 | Plus |
RpS4-RB | 1327 | RpS4-RB | 338..1234 | 82..978 | 4485 | 100 | Plus |
RpS4.b | 1551 | RpS4.b | 338..1234 | 82..978 | 4485 | 100 | Plus |
RpS4-RB | 1327 | RpS4-RB | 113..194 | 1..82 | 410 | 100 | Plus |
RpS4.b | 1551 | RpS4.b | 113..194 | 1..82 | 410 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 13033874..13034206 | 644..976 | 1665 | 100 | Plus |
chr3L | 24539361 | chr3L | 13032410..13032669 | 115..374 | 1300 | 100 | Plus |
chr3L | 24539361 | chr3L | 13033465..13033639 | 471..645 | 875 | 100 | Plus |
chr3L | 24539361 | chr3L | 13032742..13032840 | 374..472 | 495 | 100 | Plus |
chr3L | 24539361 | chr3L | 13032057..13032138 | 1..82 | 410 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 13043573..13043907 | 644..978 | 1675 | 100 | Plus |
3L | 28110227 | 3L | 13042109..13042368 | 115..374 | 1300 | 100 | Plus |
3L | 28110227 | 3L | 13043164..13043338 | 471..645 | 875 | 100 | Plus |
3L | 28110227 | 3L | 13042441..13042539 | 374..472 | 495 | 100 | Plus |
3L | 28110227 | 3L | 13041756..13041837 | 1..82 | 410 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 13036673..13037007 | 644..978 | 1675 | 100 | Plus |
3L | 28103327 | 3L | 13035209..13035468 | 115..374 | 1300 | 100 | Plus |
3L | 28103327 | 3L | 13036264..13036438 | 471..645 | 875 | 100 | Plus |
3L | 28103327 | 3L | 13035541..13035639 | 374..472 | 495 | 100 | Plus |
3L | 28103327 | 3L | 13034856..13034937 | 1..82 | 410 | 100 | Plus |
3L | 28103327 | 3L | 13035081..13035115 | 82..116 | 175 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 13032057..13032138 | 1..82 | 100 | -> | Plus |
chr3L | 13032283..13032315 | 83..115 | 100 | -> | Plus |
chr3L | 13032411..13032669 | 116..374 | 100 | -> | Plus |
chr3L | 13032743..13032840 | 375..472 | 100 | -> | Plus |
chr3L | 13033467..13033638 | 473..644 | 100 | -> | Plus |
chr3L | 13033875..13034206 | 645..976 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RB | 1..786 | 113..898 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RB | 1..786 | 113..898 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..786 | 113..898 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RB | 1..786 | 113..898 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..786 | 113..898 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..976 | 1..976 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..976 | 1..976 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..976 | 1..976 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..976 | 1..976 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS4-RA | 1..976 | 1..976 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13043574..13043905 | 645..976 | 100 | Plus | |
3L | 13041756..13041837 | 1..82 | 100 | -> | Plus |
3L | 13041982..13042014 | 83..115 | 100 | -> | Plus |
3L | 13042110..13042368 | 116..374 | 100 | -> | Plus |
3L | 13042442..13042539 | 375..472 | 100 | -> | Plus |
3L | 13043166..13043337 | 473..644 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13043574..13043905 | 645..976 | 100 | Plus | |
3L | 13041756..13041837 | 1..82 | 100 | -> | Plus |
3L | 13041982..13042014 | 83..115 | 100 | -> | Plus |
3L | 13042110..13042368 | 116..374 | 100 | -> | Plus |
3L | 13042442..13042539 | 375..472 | 100 | -> | Plus |
3L | 13043166..13043337 | 473..644 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13043574..13043905 | 645..976 | 100 | Plus | |
3L | 13041756..13041837 | 1..82 | 100 | -> | Plus |
3L | 13041982..13042014 | 83..115 | 100 | -> | Plus |
3L | 13042110..13042368 | 116..374 | 100 | -> | Plus |
3L | 13042442..13042539 | 375..472 | 100 | -> | Plus |
3L | 13043166..13043337 | 473..644 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 13036266..13036437 | 473..644 | 100 | -> | Plus |
arm_3L | 13036674..13037005 | 645..976 | 100 | Plus | |
arm_3L | 13034856..13034937 | 1..82 | 100 | -> | Plus |
arm_3L | 13035082..13035114 | 83..115 | 100 | -> | Plus |
arm_3L | 13035210..13035468 | 116..374 | 100 | -> | Plus |
arm_3L | 13035542..13035639 | 375..472 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13035210..13035468 | 116..374 | 100 | -> | Plus |
3L | 13035542..13035639 | 375..472 | 100 | -> | Plus |
3L | 13036266..13036437 | 473..644 | 100 | -> | Plus |
3L | 13036674..13037005 | 645..976 | 100 | Plus | |
3L | 13034856..13034937 | 1..82 | 100 | -> | Plus |
3L | 13035082..13035114 | 83..115 | 100 | -> | Plus |
Translation from 112 to 897
> RE57333.pep MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRN RLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFR LVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYP DPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRER HPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAE ERDKRLAAKTH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24027-PA | 261 | GF24027-PA | 1..261 | 1..261 | 1357 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15623-PA | 261 | GG15623-PA | 1..261 | 1..261 | 1367 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17143-PA | 261 | GH17143-PA | 1..261 | 1..261 | 1345 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS4-PC | 261 | CG11276-PC | 1..261 | 1..261 | 1356 | 100 | Plus |
RpS4-PB | 261 | CG11276-PB | 1..261 | 1..261 | 1356 | 100 | Plus |
RpS4-PA | 261 | CG11276-PA | 1..261 | 1..261 | 1356 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11752-PA | 261 | GI11752-PA | 1..261 | 1..261 | 1344 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25330-PA | 261 | GL25330-PA | 1..261 | 1..261 | 1341 | 96.9 | Plus |
Dper\GL26779-PA | 135 | GL26779-PA | 1..128 | 90..254 | 186 | 37.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10883-PA | 261 | GA10883-PA | 1..261 | 1..261 | 1341 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25394-PA | 261 | GM25394-PA | 1..261 | 1..261 | 1370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14426-PA | 261 | GD14426-PA | 1..261 | 1..261 | 1370 | 100 | Plus |
Dsim\GD17639-PA | 145 | GD17639-PA | 1..126 | 1..124 | 629 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13462-PA | 261 | GJ13462-PA | 1..261 | 1..261 | 1346 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17425-PA | 261 | GK17425-PA | 1..261 | 1..261 | 1353 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS4-PA | 261 | GE21948-PA | 1..261 | 1..261 | 1365 | 99.2 | Plus |
Translation from 112 to 897
> RE57333.hyp MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRN RLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFR LVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYP DPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRER HPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAE ERDKRLAAKTH*