Clone RE57443 Report

Search the DGRC for RE57443

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:574
Well:43
Vector:pFlc-1
Associated Gene/TranscriptNijA-RA
Protein status:RE57443.pep: gold
Preliminary Size:591
Sequenced Size:1146

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6449 2001-12-14 Blastp of sequenced clone
CG6449 2002-01-01 Sim4 clustering to Release 2
CG6449 2003-01-01 Sim4 clustering to Release 3
NijA 2008-04-29 Release 5.5 accounting
NijA 2008-08-15 Release 5.9 accounting
NijA 2008-12-18 5.12 accounting

Clone Sequence Records

RE57443.complete Sequence

1146 bp (1146 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071530

> RE57443.complete
CAGTTGTCCGAGAAATAGCGTGCCGAGCGGTCGCAAATTGCGCACGAGTT
TTTAAACAAAAGCCAAAAAAAAAACAAAATAATAAATAAGCAACAGAGTG
ATTTGCCCGAGAAGGTCTAGATAAAGAGATACAAAGAAATTCTTAAGGAA
TCTTGGCATTGAATTGCTCATTTGTAATTGCCCAAAGACATATTAATTGC
AATTAATTAATTAATTAATTCAATCGTAAAATGAGTAACCTAGAGCATAT
TACGCTGGAAATGGATAAAGTGCCACTAGGAGATAATAAAACTTTGGAAA
ATATCAGCAAACACAGCTATGGCGGTGCAATCGACGGACGGACACGTAAT
ACTCTTCGAGTGCCCAGAGCAGTTCCAGAAACCGATGATGATGACAACGA
CGATCGTCCCTTTGTTAAAGATGGCAATGATAATCCCGGCGTGGATGACG
GTCTTTTTTCAACTGTTGGAGGCAACGGAGGCAACGGCGGCAATGTGAAT
GTAAACGTTCCCAATGGAGGAAGACGACCCAGTTTCTCCTTTCCGGGATA
CAATGGACCCGGTTTTGTGACGATCAACGGCGTGGAGACACCCATACCCG
ATGTGAATGCATATCAGCACAAGAAGACCCTGGCTCAGGGAATGATGGAC
CTGGCACTTCTCTCCGCGAATGCAAATCAATTGCGTTATGTTCTGGAGAC
GAGCTCACAACATCCTTACTTTTATCCCAGTCTGCTGTTCATCTCACTCA
GCATTATATTCCAGATTGCTGTGGGCGTGGGCCTTATATTGAATGGCCAG
TATAACATCAAAAACGGTCACGATATCTGCCGGGCGAACAGGATCAATAA
TTATACAGTTAGCGGCATTTTTATAGTCACTGTGGTCAATGTTCTAATAT
CAGCCTTTACTGTGGACAGAGATACTGTGCCTGCTTTACCCGCCAATACA
ACATAGTTTAACTTGTATTTTAAATAGACTTTAGTATTATGAACACACAG
ATGCATCTTTAGATAATACTCACATTGTTCAAACCTTGTTAAATTTCACT
CAGCTACTCATTTTTCTAAACGCAACAATGAATTGTGATAAATAAAATCC
CACGAGCATTTCTCGCTTATTTAAATAACTGAAAAAAAAAAAAAAA

RE57443.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
NijA-RA 1201 NijA-RA 1..1134 1..1134 5640 99.8 Plus
NijA-RB 1213 NijA-RB 309..1146 297..1134 4160 99.7 Plus
NijA-RC 1165 NijA-RC 383..1098 419..1134 3565 99.8 Plus
NijA-RB 1213 NijA-RB 1..297 1..297 1485 100 Plus
NijA-RC 1165 NijA-RC 1..297 1..297 1485 100 Plus
NijA-RC 1165 NijA-RC 309..384 297..372 380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10686303..10686696 764..371 1850 98 Minus
chr3L 24539361 chr3L 10685649..10686020 1128..758 1690 97.6 Minus
chr3L 24539361 chr3L 10687831..10688136 297..1 1250 95.4 Minus
chr3L 24539361 chr3L 10686911..10686987 372..296 370 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10695024..10695417 764..371 1955 99.7 Minus
3L 28110227 3L 10694357..10694733 1134..758 1855 99.5 Minus
3L 28110227 3L 10696578..10696874 297..1 1485 100 Minus
3L 28110227 3L 10695629..10695705 372..296 385 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10688124..10688517 764..371 1955 99.7 Minus
3L 28103327 3L 10687457..10687833 1134..758 1855 99.4 Minus
3L 28103327 3L 10689678..10689974 297..1 1485 100 Minus
3L 28103327 3L 10688729..10688805 372..296 385 100 Minus
Blast to na_te.dros performed 2019-03-16 13:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 6416..6628 49..268 155 57 Plus
accord2 7650 accord2 QBERT 7650bp 6583..6636 93..39 137 74.5 Minus
412 7567 412 412 7567bp 1732..1793 36..97 112 64.5 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1388..1425 55..93 111 79.5 Plus

RE57443.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:22 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10685646..10686013 765..1131 97 <- Minus
chr3L 10686303..10686694 373..764 97 <- Minus
chr3L 10686911..10686986 297..372 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:38 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..726 231..956 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:37 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..726 231..956 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:19:42 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..726 231..956 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:52 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..726 231..956 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:14 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..726 231..956 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:38 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..1131 1..1131 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:37 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..1131 1..1131 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:19:42 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 4..1134 1..1131 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:53 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 1..1131 1..1131 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:14 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
NijA-RA 4..1134 1..1131 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:22 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10695629..10695704 297..372 100 <- Minus
3L 10696579..10696874 1..296 100   Minus
3L 10694360..10694726 765..1131 99 <- Minus
3L 10695024..10695415 373..764 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:22 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10695629..10695704 297..372 100 <- Minus
3L 10696579..10696874 1..296 100   Minus
3L 10694360..10694726 765..1131 99 <- Minus
3L 10695024..10695415 373..764 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:22 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10695629..10695704 297..372 100 <- Minus
3L 10696579..10696874 1..296 100   Minus
3L 10694360..10694726 765..1131 99 <- Minus
3L 10695024..10695415 373..764 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:19:42 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10687460..10687826 765..1131 99 <- Minus
arm_3L 10688124..10688515 373..764 99 <- Minus
arm_3L 10688729..10688804 297..372 100 <- Minus
arm_3L 10689679..10689974 1..296 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:51 Download gff for RE57443.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10687460..10687826 765..1131 99 <- Minus
3L 10688124..10688515 373..764 99 <- Minus
3L 10688729..10688804 297..372 100 <- Minus
3L 10689679..10689974 1..296 100   Minus

RE57443.pep Sequence

Translation from 230 to 955

> RE57443.pep
MSNLEHITLEMDKVPLGDNKTLENISKHSYGGAIDGRTRNTLRVPRAVPE
TDDDDNDDRPFVKDGNDNPGVDDGLFSTVGGNGGNGGNVNVNVPNGGRRP
SFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLSANANQ
LRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDIC
RANRINNYTVSGIFIVTVVNVLISAFTVDRDTVPALPANTT*

RE57443.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23821-PA 231 GF23821-PA 1..230 1..234 829 78 Plus
Dana\GF17117-PA 212 GF17117-PA 11..75 115..179 181 52.3 Plus
Dana\GF23648-PA 179 GF23648-PA 74..172 126..227 164 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13962-PA 235 GG13962-PA 1..235 1..241 871 80.1 Plus
Dere\GG16012-PA 180 GG16012-PA 11..173 66..227 205 30.1 Plus
Dere\GG19192-PA 203 GG19192-PA 5..147 124..234 204 33.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15570-PA 228 GH15570-PA 1..225 1..233 768 71.2 Plus
Dgri\GH21383-PA 222 GH21383-PA 5..147 124..234 202 33.6 Plus
Dgri\GH14600-PA 174 GH14600-PA 69..167 126..227 160 41 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
NijA-PA 241 CG6449-PA 1..241 1..241 1266 100 Plus
NijA-PB 245 CG6449-PB 1..245 1..241 1251 98.4 Plus
NijA-PD 225 CG6449-PD 1..225 1..241 1149 93.4 Plus
NijA-PC 229 CG6449-PC 1..229 1..241 1134 91.8 Plus
NijC-PD 138 CG14394-PD 4..127 111..234 254 41.1 Plus
NijC-PF 133 CG14394-PF 12..122 124..234 247 43.2 Plus
NijC-PB 135 CG14394-PB 4..126 111..237 227 38.6 Plus
NijC-PG 130 CG14394-PG 12..121 124..237 220 40.4 Plus
NijC-PC 136 CG14394-PC 4..122 111..226 206 40.3 Plus
NijC-PE 131 CG14394-PE 12..117 124..226 199 42.5 Plus
NijB-PA 181 CG11637-PA 75..173 126..227 190 37.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16845-PA 228 GI16845-PA 1..225 1..234 747 70.8 Plus
Dmoj\GI13486-PA 170 GI13486-PA 67..163 128..227 201 40.8 Plus
Dmoj\GI10503-PA 222 GI10503-PA 5..60 124..179 172 55.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20739-PA 243 GL20739-PA 1..243 1..235 775 74.8 Plus
Dper\GL24423-PA 181 GL24423-PA 28..170 124..234 199 33.6 Plus
Dper\GL24889-PA 173 GL24889-PA 68..166 126..227 156 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19603-PA 245 GA19603-PA 1..245 1..235 777 74.2 Plus
Dpse\GA12950-PE 141 GA12950-PE 11..130 115..234 248 40.8 Plus
Dpse\GA12950-PH 126 GA12950-PH 5..115 124..234 239 42.3 Plus
Dpse\GA12950-PF 126 GA12950-PF 5..116 124..239 213 38.8 Plus
Dpse\GA12950-PC 126 GA12950-PC 5..110 124..226 184 42.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24800-PA 182 GM24800-PA 1..117 1..118 431 84.7 Plus
Dsec\GM24800-PA 182 GM24800-PA 100..182 162..241 269 72.3 Plus
Dsec\GM24058-PA 170 GM24058-PA 2..159 109..234 214 32.3 Plus
Dsec\GM15001-PA 177 GM15001-PA 75..173 126..227 193 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12851-PA 246 GD12851-PA 1..246 1..241 1024 91.5 Plus
Dsim\GD18856-PA 209 GD18856-PA 2..146 109..221 191 32.4 Plus
Dsim\GD14779-PA 90 GD14779-PA 1..86 139..227 154 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12595-PA 230 GJ12595-PA 1..227 1..235 718 66.2 Plus
Dvir\GJ23184-PA 158 GJ23184-PA 5..147 124..234 203 33.6 Plus
Dvir\GJ11847-PA 171 GJ11847-PA 68..164 128..227 154 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17290-PA 226 GK17290-PA 1..217 1..228 770 72.6 Plus
Dwil\GK20451-PA 243 GK20451-PA 128..238 114..227 218 40.4 Plus
Dwil\GK13730-PA 235 GK13730-PA 5..147 124..234 200 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20261-PA 231 GE20261-PA 1..215 1..226 802 77.9 Plus
Dyak\GE14598-PA 61 GE14598-PA 3..61 94..156 244 79.4 Plus
Dyak\GE26216-PA 232 GE26216-PA 5..147 124..234 204 33.6 Plus
Dyak\GE19577-PA 180 GE19577-PA 75..172 127..227 189 38.2 Plus
Dyak\GE19573-PA 180 GE19573-PA 75..172 127..227 189 38.2 Plus

RE57443.hyp Sequence

Translation from 230 to 955

> RE57443.hyp
MSNLEHITLEMDKVPLGDNKTLENISKHSYGGAIDGRTRNTLRVPRAVPE
TDDDDNDDRPFVKDGNDNPGVDDGLFSTVGGNGGNGGNVNVNVPNGGRRP
SFSFPGYNGPGFVTINGVETPIPDVNAYQHKKTLAQGMMDLALLSANANQ
LRYVLETSSQHPYFYPSLLFISLSIIFQIAVGVGLILNGQYNIKNGHDIC
RANRINNYTVSGIFIVTVVNVLISAFTVDRDTVPALPANTT*

RE57443.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
NijA-PA 241 CG6449-PA 1..241 1..241 1266 100 Plus
NijA-PB 245 CG6449-PB 1..245 1..241 1251 98.4 Plus
NijA-PD 225 CG6449-PD 1..225 1..241 1149 93.4 Plus
NijA-PC 229 CG6449-PC 1..229 1..241 1134 91.8 Plus
NijC-PD 138 CG14394-PD 4..127 111..234 254 41.1 Plus